Compile Data Set for Download or QSAR
maximum 50k data
Found 113 with Last Name = 'green' and Initial = 'br'
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273370(CHEMBL503473 | GWTLNSAGYLLGPPPGFSPFR-CONH2 | Galan...)
Affinity DataKi:  0.0100nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50378616(GALANIN)
Affinity DataKi:  0.0300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273369(CHEMBL526003 | GWTLNSAGYLLGPQQFFGLM-CONH2 | Galani...)
Affinity DataKi:  0.0300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307256(CHEMBL604373 | GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 | Ga...)
Affinity DataKi:  0.0800nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307254(CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40)
Affinity DataKi:  0.100nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307255(CHEMBL592413 | GWTLNSAGYLLGPRHYINLITRQRY-CONH2)
Affinity DataKi:  0.300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293023((Sar)WTLNSAGYLLGPKKKK | CHEMBL508036)
Affinity DataKi:  0.400nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273353((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Affinity DataKi:  0.400nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293024((Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K | CHEMBL505299)
Affinity DataKi:  0.5nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273351(CHEMBL508083 | GWTLNSAGYLLGPHAV-NH2)
Affinity DataKi:  0.5nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307256(CHEMBL604373 | GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 | Ga...)
Affinity DataKi:  0.600nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293030((Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K | CHEMBL503900)
Affinity DataKi:  0.700nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50378616(GALANIN)
Affinity DataKi:  0.900nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273359(CHEMBL526500)
Affinity DataKi:  0.900nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273369(CHEMBL526003 | GWTLNSAGYLLGPQQFFGLM-CONH2 | Galani...)
Affinity DataKi:  1.10nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293029((Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K | CHEMBL460706)
Affinity DataKi:  1.30nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307255(CHEMBL592413 | GWTLNSAGYLLGPRHYINLITRQRY-CONH2)
Affinity DataKi:  1.40nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293028((Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K | CHEMBL507733)
Affinity DataKi:  1.40nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307254(CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40)
Affinity DataKi:  1.5nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307252(CHEMBL578710 | WTLNSAGYLL-CONH2)
Affinity DataKi:  1.70nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307258(CHEMBL578317 | [N-Ac,des-Sar]Gal-B2)
Affinity DataKi:  1.70nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273370(CHEMBL503473 | GWTLNSAGYLLGPPPGFSPFR-CONH2 | Galan...)
Affinity DataKi:  1.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273354(CHEMBL525755)
Affinity DataKi:  1.90nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293027((Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K | CHEMBL524678)
Affinity DataKi:  2.60nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273360((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  2.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273362(CHEMBL505336)
Affinity DataKi:  3.30nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307250(CHEMBL578514 | GalB2)
Affinity DataKi:  3.5nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273355(CHEMBL525023)
Affinity DataKi:  3.5nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293026((Sar)WTLNSAGYLLGPKK(Lys-palmitoyl)K | CHEMBL507353)
Affinity DataKi:  3.5nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307250(CHEMBL578514 | GalB2)
Affinity DataKi:  3.5nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50426597(CHEMBL2324950)
Affinity DataKi:  3.80nMAssay Description:Displacement of euporium-galanin from human GalR1 after 1.5 hrs by DELFIA assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293025((Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K | CHEMBL450827)
Affinity DataKi:  4nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273360((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  5.30nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273356(CHEMBL504914)
Affinity DataKi:  6nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307253(CHEMBL592415 | WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2)
Affinity DataKi:  9.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307257(CHEMBL578910 | [Sar1Ala]GAL-B2)
Affinity DataKi:  11nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273351(CHEMBL508083 | GWTLNSAGYLLGPHAV-NH2)
Affinity DataKi:  13nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293029((Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K | CHEMBL460706)
Affinity DataKi:  14nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273359(CHEMBL526500)
Affinity DataKi:  15nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293030((Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K | CHEMBL503900)
Affinity DataKi:  15nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293025((Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K | CHEMBL450827)
Affinity DataKi:  15nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293028((Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K | CHEMBL507733)
Affinity DataKi:  16nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50426597(CHEMBL2324950)
Affinity DataKi:  16nMAssay Description:Displacement of euporium-galanin from human GalR2 after 1.5 hrs by DELFIA assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307258(CHEMBL578317 | [N-Ac,des-Sar]Gal-B2)
Affinity DataKi:  16nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273360((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  18nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293027((Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K | CHEMBL524678)
Affinity DataKi:  18nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307259(CHEMBL604991 | [N-Me,des-Sar]Gal-B2)
Affinity DataKi:  20nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293024((Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K | CHEMBL505299)
Affinity DataKi:  21nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273354(CHEMBL525755)
Affinity DataKi:  22nMAssay Description:Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273361((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  22nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 113 total ) | Next | Last >>
Jump to: