BDBM301510 US10131673, Compound P37
US9303033, P37, Table 41A, Compound 28 BDBM219783
5-(4-chlorophenyl)-6-methylpyrimidine-2,4-diamine BDBM18775 P37 CHEMBL21357
QF-peptide BDBM23993 Peptide contains an aggrecanase cleavage site
BDBM50119057 CHEMBL438599 ALCDNPRIDRWYCQFVEG peptide analogue Biotinylated E-76 peptide analogue
CHEMBL409918 BDBM50119050 ALCDNPRIDRWYCQFVEG peptide analogue Biotinylated E-76 peptide analogue
2-(3-chloropyridin- 4-yl)-1-(7-fluoro- 5-(2-((1-methyl- 1H-pyrazol- 5-yl)amino) pyrimidin-4-yl) indolin-1-yl)ethan- 1-one BDBM575758 US11465984, Example P37
BDBM50034573 Peptide boronate CHEMBL291261
BDBM50034574 CHEMBL288150 Peptide boronate
BDBM50034575 CHEMBL36670 Peptide boronate
BDBM50034576 Peptide boronate CHEMBL288176
BDBM50034579 CHEMBL290577 Peptide boronate
BDBM50034584 Peptide boronate CHEMBL288175
BDBM50034585 Peptide boronate CHEMBL285285
BDBM50034586 Peptide boronate CHEMBL291085
BDBM50034587 CHEMBL288407 Peptide boronate
BDBM50034588 CHEMBL286606 Peptide boronate
BDBM50034589 CHEMBL288689 Peptide boronate
BDBM50132594 Dimeric peptide CHEMBL2370429
BDBM50132595 CHEMBL2370433 Dimeric peptide
BDBM50132597 CHEMBL2370430 Dimeric peptide
CHEMBL2370434 BDBM50132596 Dimeric peptide
CHEMBL2448441 Peptide boronate BDBM50034582
CHEMBL291026 BDBM50034577 Peptide boronate
CHEMBL418050 Peptide boronate BDBM50034580
CHEMBL430545 BDBM50034590 Peptide boronate
CHEMBL431115 BDBM50034578 Peptide boronate
Dimeric peptide BDBM50132592 CHEMBL2370428
Peptide boronate BDBM50034581 CHEMBL36744
Peptide boronate BDBM50034583 CHEMBL287918
SWH peptide ISADAMMQALLGARAKES BDBM231692
Pyrrolidine Carboxamide Compound p37 4-({4-[(4-chlorophenyl)(phenyl)methyl]piperazin-1-yl}carbonyl)-1-cyclohexylpyrrolidin-2-one BDBM15690 1-Cyclohexyl-4-(1-(phenyl(4-chlorophenyl)methyl)piperazine-4-carbonyl)pyrrolidin-2-one
BDBM50080120 Cyclo peptide analogue CHEMBL409686
BDBM50127212 CHEMBL2372335 ALCDNPRIDRWYCQFVEG peptide analogue
BDBM50127213 CHEMBL2372340 ALCDNPRIDRWYCQFVEG peptide analogue
BDBM50127214 CHEMBL2372334 ALCDNPRIDRWYCQFVEG peptide analogue
BDBM50131113 Cyclic peptide analogue CHEMBL410479
BDBM655769 US20240066136,Peptide 5 KVLHKRTLG
BDBM655770 US20240066136,Peptide 6 NFTSRLNRRASFP
BDBM91675 Peptide-peptoid hybrid, 6q
CHEMBL2370886 Peptide BACE derivative BDBM50134704
CHEMBL414817 Cyclo peptide analogue BDBM50080125
Cyclic peptide analogue BDBM50131110 CHEMBL437226
Cyclic peptide analogue CHEMBL410280 BDBM50131112
Cyclo peptide analogue BDBM50080118 CHEMBL441328
Cyclo peptide analogue BDBM50080119 CHEMBL412817
Cyclo peptide analogue BDBM50080121 CHEMBL411591
Cyclo peptide analogue CHEMBL405106 BDBM50080123
Cyclo peptide analogue CHEMBL407228 BDBM50080124
Cyclo peptide analogue CHEMBL407859 BDBM50080122
H3K27Me3 peptide BDBM231631 Biotin-KAPRKQLATKAARKMe3SAPATGG
ILPKVLHKRTFGL BDBM655768 US20240066136,Peptide 4
ILPKVLHKRTLGLS US20240066136,Peptide 1 BDBM655765
Peptide-peptoid hybrid, 13 BDBM91677
Peptide-peptoid hybrid, 7 BDBM91676
SCR-2 peptide HDSKGQTKLLQLLTTKSDQM BDBM227647
US20240066136,Peptide 2 ILPKVWHKRELGLS BDBM655766
US20240066136,Peptide 3 ILPKVLHKRTLGL BDBM655767
US20240066136,Peptide 7 BDBM655771 SRLNRRASF
BDBM50102031 CHEMBL2372986 Derivative of T140 peptide
BDBM50102033 CHEMBL2372983 Derivative of T140 peptide
BDBM50102034 CHEMBL2372995 Derivative of T140 peptide
BDBM50102041 Derivative of T140 peptide CHEMBL2372990
BDBM50102042 CHEMBL2373000 Derivative of T140 peptide
BDBM50102044 CHEMBL2373002 Derivative of T140 peptide
BDBM50102045 Derivative of T140 peptide CHEMBL2373003
BDBM50112318 Atrial natriuretic peptide analogue CHEMBL409400
BDBM50112319 CHEMBL412345 Atrial natriuretic peptide analogue
BDBM50112324 Atrial natriuretic peptide analogue CHEMBL408343
BDBM50120302 Peptide Boronic Acid analogue CHEMBL108449
BDBM50120303 Peptide Boronic Acid analogue CHEMBL432959
BDBM50120313 Peptide Boronic Acid analogue CHEMBL320103
BDBM50120314 Peptide Boronic Acid analogue CHEMBL321894
BDBM50120742 cyclic uPA-derived peptide CHEMBL264653
BDBM50120743 cyclic uPA-derived peptide CHEMBL385968
CHEMBL1253325 PKYVKQNTLKLAT (HA306-318 peptide) BDBM50287632
CHEMBL217327 cyclic uPA-derived peptide BDBM50120748
CHEMBL2372985 Derivative of T140 peptide BDBM50102036
CHEMBL2372989 BDBM50102046 Derivative of T140 peptide
CHEMBL2372996 Derivative of T140 peptide BDBM50102038
CHEMBL2372997 BDBM50102035 Derivative of T140 peptide
CHEMBL2372998 Derivative of T140 peptide BDBM50102039
CHEMBL2372999 Derivative of T140 peptide BDBM50102048
CHEMBL2373001 Derivative of T140 peptide BDBM50102032
CHEMBL262398 Peptide Boronic Acid analogue BDBM50120306
CHEMBL322277 Peptide Boronic Acid analogue BDBM50120301
CHEMBL322784 Peptide Boronic Acid analogue BDBM50120283
CHEMBL326207 Peptide Boronic Acid analogue BDBM50120294
CHEMBL384862 Atrial natriuretic peptide analogue BDBM50112316
CHEMBL385216 BDBM50112322 Atrial natriuretic peptide analogue
CHEMBL402664 Atrial natriuretic peptide analogue BDBM50112325
CHEMBL413653 Atrial natriuretic peptide analogue BDBM50112326
CHEMBL414517 Atrial natriuretic peptide analogue BDBM50112323
CHEMBL419567 Peptide Boronic Acid analogue BDBM50120289
Derivative of T140 peptide BDBM50102043 CHEMBL2373005
Derivative of T140 peptide CHEMBL2372993 BDBM50102037
Derivative of T140 peptide CHEMBL2373004 BDBM50102047
Peptide Boronic Acid analogue BDBM50120286 CHEMBL322933
Peptide Boronic Acid analogue BDBM50120287 CHEMBL109483
Peptide Boronic Acid analogue BDBM50120291 CHEMBL107869
Peptide Boronic Acid analogue BDBM50120296 CHEMBL419918
Peptide Boronic Acid analogue BDBM50120297 CHEMBL278908
Peptide Boronic Acid analogue BDBM50120298 CHEMBL109434
Peptide Boronic Acid analogue BDBM50120299 CHEMBL110828
Peptide Boronic Acid analogue BDBM50120300 CHEMBL431246
Peptide Boronic Acid analogue BDBM50120304 CHEMBL108815
Peptide Boronic Acid analogue BDBM50120310 CHEMBL109592
Peptide Boronic Acid analogue BDBM50120311 CHEMBL320814
Peptide Boronic Acid analogue BDBM50120312 CHEMBL325081
Peptide Boronic Acid analogue CHEMBL107287 BDBM50120290
Peptide Boronic Acid analogue CHEMBL107656 BDBM50120284
Peptide Boronic Acid analogue CHEMBL108189 BDBM50120309
Peptide Boronic Acid analogue CHEMBL108657 BDBM50120285
Peptide Boronic Acid analogue CHEMBL111765 BDBM50120305
Peptide Boronic Acid analogue CHEMBL263941 BDBM50120307
Peptide Boronic Acid analogue CHEMBL322110 BDBM50120292
Peptide Boronic Acid analogue CHEMBL324207 BDBM50120295
Peptide Boronic Acid analogue CHEMBL413150 BDBM50120293
Peptide Boronic Acid analogue CHEMBL432978 BDBM50120288
Peptide Boronic Acid analogue CHEMBL443537 BDBM50120308
cyclic uPA-derived peptide BDBM50120740 CHEMBL405999
cyclic uPA-derived peptide BDBM50120741 CHEMBL437837
cyclic uPA-derived peptide BDBM50120749 CHEMBL412223
cyclic uPA-derived peptide BDBM50120750 CHEMBL269566
cyclic uPA-derived peptide CHEMBL263158 BDBM50120745
cyclic uPA-derived peptide CHEMBL405302 BDBM50120746
cyclic uPA-derived peptide CHEMBL412236 BDBM50120747
cyclic uPA-derived peptide CHEMBL438371 BDBM50120744
BDBM253650 US10632171, Peptide No. 96 US9458201, 96
BDBM50000135 CHEMBL415204 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000137 CHEMBL263845 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000138 CHEMBL384014 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000145 CHEMBL386344 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000146 CHEMBL414299 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000149 CHEMBL261954 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000155 CHEMBL265013 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000159 CHEMBL331824 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000162 CHEMBL263439 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000163 CHEMBL386716 Ribonucleotide reductase inhibiting peptide analogue
BDBM50000164 Ribonucleotide reductase inhibiting peptide analogue CHEMBL405583
BDBM50119047 CHEMBL441926 Biotinylated E-76 peptide analogue
BDBM50119048 Biotinylated E-76 peptide analogue CHEMBL437872
BDBM50119049 CHEMBL439285 Biotinylated E-76 peptide analogue
BDBM50119052 CHEMBL269354 Biotinylated E-76 peptide analogue
BDBM50119053 CHEMBL415402 Biotinylated E-76 peptide analogue
BDBM50119056 CHEMBL439444 Biotinylated E-76 peptide analogue
BDBM50126085 MT-II cyclic peptide derivative CHEMBL384036
BDBM50126086 MT-II cyclic peptide derivative CHEMBL24892
BDBM50126096 MT-II cyclic peptide derivative CHEMBL439361
BDBM50126097 MT-II cyclic peptide derivative CHEMBL264337
CHEMBL2371888 MT-II cyclic peptide derivative BDBM50126104
CHEMBL261962 BDBM50000157 Ribonucleotide reductase inhibiting peptide analogue
CHEMBL277280 BDBM50000152 Ribonucleotide reductase inhibiting peptide analogue
CHEMBL386066 BDBM50000153 Ribonucleotide reductase inhibiting peptide analogue
CHEMBL407206 mintANP BDBM50112321 Atrial natriuretic peptide analogue
CHEMBL407754 MT-II cyclic peptide derivative BDBM50126090
CHEMBL410279 BDBM50119058 Biotinylated E-76 peptide analogue
CHEMBL410836 BDBM50119059 Biotinylated E-76 peptide analogue
CHEMBL414777 BDBM50119055 Biotinylated E-76 peptide analogue
CHEMBL415341 MT-II cyclic peptide derivative BDBM50126087
CHEMBL415837 BDBM50119051 Biotinylated E-76 peptide analogue
CHEMBL429011 BDBM50119054 Biotinylated E-76 peptide analogue
CHEMBL437817 BDBM50000165 Ribonucleotide reductase inhibiting peptide analogue
CHEMBL440253 BDBM50000150 Ribonucleotide reductase inhibiting peptide analogue
MT-II cyclic peptide derivative BDBM50126084 CHEMBL412174
MT-II cyclic peptide derivative BDBM50126088 CHEMBL409786
MT-II cyclic peptide derivative BDBM50126089 CHEMBL2371913
MT-II cyclic peptide derivative BDBM50126092 CHEMBL2371902
MT-II cyclic peptide derivative BDBM50126098 CHEMBL262437
MT-II cyclic peptide derivative BDBM50126099 CHEMBL410148
MT-II cyclic peptide derivative BDBM50126102 CHEMBL2371903
MT-II cyclic peptide derivative BDBM50126105 CHEMBL2371880
MT-II cyclic peptide derivative CHEMBL216474 BDBM50126091
MT-II cyclic peptide derivative CHEMBL2371887 BDBM50126083
MT-II cyclic peptide derivative CHEMBL386871 BDBM50126093
MT-II cyclic peptide derivative CHEMBL406636 BDBM50126103
MT-II cyclic peptide derivative CHEMBL437822 BDBM50126094
MT-II cyclic peptide derivative CHEMBL438286 BDBM50126101
Non-peptide bidentate ITAM analogue BDBM50290773 CHEMBL443592
Non-peptide bidentate ITAM analogue CHEMBL386787 BDBM50290771
CHEMBL429908 linear peptide of RES-701-1 BDBM50289649
Somatostatin-28 BDBM50136768 CHEMBL442315 Somatostatin analogue Peptide analogue
[Ala7]mintANP Atrial natriuretic peptide analogue CHEMBL439465 BDBM50112317
[Pro7]mintANP BDBM50112320 Atrial natriuretic peptide analogue CHEMBL405572
pΔn2Δc4 peptide ADAMMQALLGAR BDBM231693
Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 BDBM50051178 CHEMBL413011
BDBM20248 Y(p)STVVH gp130 (759) derived peptide, 3
BDBM415709 Ac-LDEETGEFL-OH US10442759, Compound Nrf2 9mer Peptide
BDBM50087726 Glucagon like peptide-1(GLP-1)analogue CHEMBL409983
BDBM50087727 CHEMBL437277 Glucagon like peptide-1(GLP-1)analogue
BDBM50087728 CHEMBL412234 Glucagon like peptide-1(GLP-1)analogue
BDBM50087729 CHEMBL439181 Glucagon like peptide-1(GLP-1)analogue
BDBM50087733 CHEMBL440075 Glucagon like peptide-1(GLP-1)analogue
BDBM50087734 CHEMBL412115 Glucagon like peptide-1(GLP-1)analogue
BDBM50087735 CHEMBL428152 Glucagon like peptide-1(GLP-1)analogue
BDBM50087737 CHEMBL427943 Glucagon like peptide-1(GLP-1)analogue
BDBM50087738 CHEMBL412541 Glucagon like peptide-1(GLP-1)analogue
BDBM50087739 CHEMBL441580 Glucagon like peptide-1(GLP-1)analogue
BDBM50087744 CHEMBL269779 Glucagon like peptide-1(GLP-1)analogue
BDBM50087745 CHEMBL439481 Glucagon like peptide-1(GLP-1)analogue
BDBM50087747 CHEMBL439305 Glucagon like peptide-1(GLP-1)analogue
BDBM50087748 Glucagon like peptide-1(GLP-1)analogue CHEMBL269494
BDBM50087749 CHEMBL261911 Glucagon like peptide-1(GLP-1)analogue
BDBM50087750 Glucagon like peptide-1(GLP-1)analogue CHEMBL409300
BDBM50087755 CHEMBL438212 Glucagon like peptide-1(GLP-1)analogue
BDBM50087756 CHEMBL439099 Glucagon like peptide-1(GLP-1)analogue
BDBM50087757 CHEMBL441931 Glucagon like peptide-1(GLP-1)analogue
BDBM50087758 CHEMBL409270 Glucagon like peptide-1(GLP-1)analogue
BDBM50087759 CHEMBL414971 Glucagon like peptide-1(GLP-1)analogue
BDBM85749 NOCICEPTIN RECEPTOR ANTAGONIST PEPTIDE III-BTD III-BTD
CHEMBL262310 BDBM50133049 Opioid Peptide [d-Ala(8)]Dynorphin derivative
CHEMBL266046 BDBM50087741 Glucagon like peptide-1(GLP-1)analogue
CHEMBL269543 Glucagon like peptide-1(GLP-1)analogue BDBM50087751
CHEMBL405057 Opioid Peptide [d-Ala(8)]Dynorphin derivative BDBM50133053
CHEMBL410575 Glucagon like peptide-1(GLP-1)analogue BDBM50087743
CHEMBL411138 Glucagon like peptide-1(GLP-1)analogue BDBM50087742
CHEMBL411170 Glucagon like peptide-1(GLP-1)analogue BDBM50087754
CHEMBL412228 Opioid Peptide [d-Ala(8)]Dynorphin derivative BDBM50133054
CHEMBL412948 BDBM50087736 Glucagon like peptide-1(GLP-1)analogue
CHEMBL424733 Glucagon like peptide-1(GLP-1)analogue BDBM50087732
CHEMBL427768 BDBM50087730 Glucagon like peptide-1(GLP-1)analogue
CHEMBL428330 Glucagon like peptide-1(GLP-1)analogue BDBM50087731
CHEMBL429351 BDBM50133048 Opioid Peptide [d-Ala(8)]Dynorphin derivative
CHEMBL429398 BDBM50087752 Glucagon like peptide-1(GLP-1)analogue
CHEMBL430245 BDBM50087761 Glucagon like peptide-1(GLP-1)analogue
CHEMBL437467 Glucagon like peptide-1(GLP-1)analogue BDBM50087740
CHEMBL439091 BDBM50087760 Glucagon like peptide-1(GLP-1)analogue
CHEMBL441203 Glucagon like peptide-1(GLP-1)analogue BDBM50087753
LIFR (1001) derived peptide, 9 BDBM20253 Y(p)KPQMH
Opioid Peptide [d-Ala(8)]Dynorphin derivative BDBM50133055 CHEMBL441198
Opioid Peptide [d-Ala(8)]Dynorphin derivative BDBM50133056 CHEMBL262838
Opioid Peptide [d-Ala(8)]Dynorphin derivative CHEMBL385696 BDBM50133050
Opioid Peptide [d-Ala(8)]Dynorphin derivative CHEMBL413832 BDBM50133051
Opioid Peptide [d-Ala(8)]Dynorphin derivative CHEMBL430081 BDBM50133052
PYY CHEMBL269503 PYY, rat Peptide YY(PYY)(YPAKPEAPGEDASPEELSRYYASLAHYLNLVTRQRY) BDBM50091652
US8846601, 122 US10632171, Peptide No. 122 BDBM135737 US9458201, 122
BDBM135751 US8846601, 136 US10632171, Peptide No. 136 US10179804, Example 136
BDBM135761 US8846601, 146 US10632171, Peptide No. 146 US10179804, Example 146
BDBM253638 US10179804, Example 53 US10632171, Peptide No. 53 US9458201, 53
BDBM253651 US10632171, Peptide No. 98 US10179804, Example 98 US9458201, 98
US10179804, Example 115 BDBM135668 US10632171, Peptide No. 115 US8846601, 53
US10179804, Example 141 US10632171, Peptide No. 141 BDBM253655 US9458201, 141
US10179804, Example 92 US9458201, 92 US10632171, Peptide No. 92 BDBM253646
US10179804, Example 94 US9458201, 94 BDBM253648 US10632171, Peptide No. 94
US10632171, Peptide No. 132 US9458201, 132 BDBM253653 US10179804, Example 132
US10632171, Peptide No. 134 US9458201, 134 BDBM253654 US10179804, Example 134
US10632171, Peptide No. 55 BDBM135670 US10179804, Example 55 US8846601, 55
US10632171, Peptide No. 57 BDBM253639 US9458201, 57 US10179804, Example 57
US9458201, 93 US10179804, Example 93 BDBM253647 US10632171, Peptide No. 93
BDBM135620 US9458201, 5 US10632171, Peptide No. 5 US8846601, 5 US10179804, Example 5
BDBM135621 US9458201, 6 US8846601, 6 US10632171, Peptide No. 6 US10179804, Example 6
BDBM135630 US10632171, Peptide No. 15 US8846601, 15 US9458201, 15 US10179804, Example 15
BDBM135631 US10632171, Peptide No. 16 US9458201, 16 US8846601, 16 US10179804, Example 16
BDBM135643 US10632171, Peptide No. 28 US9458201, 28 US8846601, 28 US10179804, Example 28
BDBM135651 US10632171, Peptide No. 36 US8846601, 36 US10179804, Example 36 US9458201, 36
BDBM135653 US10632171, Peptide No. 38 US9458201, 38 US8846601, 38 US10179804, Example 38
BDBM135663 US10632171, Peptide No. 48 US8846601, 48 US9458201, 48 US10179804, Example 48
BDBM135664 US10632171, Peptide No. 49 US9458201, 49 US8846601, 49 US10179804, Example 49
BDBM135665 US8846601, 50 US10179804, Example 50 US9458201, 50 US10632171, Peptide No. 50
BDBM135673 US10632171, Peptide No. 58 US8846601, 58 US10179804, Example 58 US9458201, 58
BDBM135675 US9458201, 60 US8846601, 60 US10179804, Example 60 US10632171, Peptide No. 60
BDBM135684 US10632171, Peptide No. 69 US8846601, 69 US10179804, Example 69 US9458201, 69
BDBM135686 US9458201, 71 US8846601, 71 US10179804, Example 71 US10632171, Peptide No. 71
BDBM135687 US8846601, 72 US10179804, Example 72 US9458201, 72 US10632171, Peptide No. 72
BDBM135694 US10632171, Peptide No. 101 US9458201, 79 US8846601, 79 US10179804, Example 79
BDBM135697 US9458201, 82 US8846601, 82 US10179804, Example 82 US10632171, Peptide No. 82
BDBM135719 US9458201, 104 US10179804, Example 104 US8846601, 104 US10632171, Peptide No. 104
BDBM135720 US9458201, 105 US10179804, Example 105 US8846601, 105 US10632171, Peptide No. 105
BDBM135740 US9458201, 125 US8846601, 125 US10632171, Peptide No. 125 US10179804, Example 125
BDBM135741 US9458201, 126 US10179804, Example 126 US8846601, 126 US10632171, Peptide No. 126
BDBM135742 US9458201, 127 US10179804, Example 127 US8846601, 127 US10632171, Peptide No. 127
BDBM135750 US9458201, 135 US8846601, 135 US10632171, Peptide No. 135 US10179804, Example 135
BDBM135752 US9458201, 137 US10179804, Example 137 US8846601, 137 US10632171, Peptide No. 137
BDBM135753 US9458201, 138 US10179804, Example 138 US8846601, 138 US10632171, Peptide No. 138
BDBM135760 US8846601, 145 US10632171, Peptide No. 145 US9458201, 145 US10179804, Example 145
BDBM135762 US9458201, 147 US8846601, 147 US10632171, Peptide No. 147 US10179804, Example 147
BDBM135763 US9458201, 148 US10179804, Example 148 US8846601, 148 US10632171, Peptide No. 148
BDBM135764 US9458201, 149 US10179804, Example 149 US8846601, 149 US10632171, Peptide No. 149
BDBM135770 US8846601, 155 US10632171, Peptide No. 155 US9458201, 155 US10179804, Example 155
BDBM135771 US8846601, 156 US10632171, Peptide No. 156 US9458201, 156 US10179804, Example 156
BDBM135772 US9458201, 157 US8846601, 157 US10632171, Peptide No. 157 US10179804, Example 157
BDBM135773 US9458201, 158 US8846601, 158 US10632171, Peptide No. 158 US10179804, Example 158
BDBM135774 US9458201, 159 US10179804, Example 159 US8846601, 159 US10632171, Peptide No. 159
BDBM135775 US8846601, 160 US10632171, Peptide No. 160 US10179804, Example 160 US9458201, 160
BDBM287915 CNP-53 Natriuretic peptide, C-type US10087144, Compound CNP CNP-22
BDBM50051170 CHEMBL412600 Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2
BDBM50051171 CHEMBL384485 Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2
BDBM50051180 Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 CHEMBL387083
BDBM50051181 CHEMBL387437 Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2
BDBM50087746 GLP-1(7-37) Glucagon like peptide-1(GLP-1) CHEMBL428139
CHEMBL217049 Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 BDBM50051173
CHEMBL264733 Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 BDBM50051177
CHEMBL409974 BDBM50051169 Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2
CHEMBL412580 Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 BDBM50051179
Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 BDBM50051172 CHEMBL386170
Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 BDBM50051176 CHEMBL277132
Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 CHEMBL216182 BDBM50051174
Cyclic Lactam Peptide Analogues of Dynorphin A(1-11)-NH2 CHEMBL415339 BDBM50051175
US10179804, Example 120 US8846601, 120 US10632171, Peptide No. 120 US9458201, 120 BDBM135735
US10179804, Example 130 US8846601, 130 US10632171, Peptide No. 130 BDBM135745 US9458201, 130
US10179804, Example 131 US8846601, 131 US10632171, Peptide No. 131 US9458201, 131 BDBM135746
US10179804, Example 140 US8846601, 140 US10632171, Peptide No. 140 BDBM135755 US9458201, 140
US10179804, Example 142 US8846601, 142 US10632171, Peptide No. 142 US9458201, 142 BDBM135757
US10179804, Example 151 US8846601, 151 US10632171, Peptide No. 151 BDBM135766 US9458201, 151
US10179804, Example 152 US8846601, 152 US10632171, Peptide No. 152 BDBM135767 US9458201, 152
US10179804, Example 153 US8846601, 153 US10632171, Peptide No. 153 US9458201, 153 BDBM135768
US10179804, Example 162 US8846601, 162 US10632171, Peptide No. 162 BDBM135777 US9458201, 162
US10179804, Example 19 US8846601, 19 US9458201, 19 US10632171, Peptide No. 19 BDBM135634
US10179804, Example 41 US10632171, Peptide No. 41 US9458201, 41 BDBM135656 US8846601, 41
US10179804, Example 63 US10632171, Peptide No. 63 US9458201, 63 BDBM135678 US8846601, 63
US10179804, Example 64 BDBM135679 US10632171, Peptide No. 64 US9458201, 64 US8846601, 64
US10179804, Example 70 US9458201, 70 BDBM135685 US8846601, 70 US10632171, Peptide No. 70
US10179804, Example 74 US10632171, Peptide No. 74 US9458201, 74 BDBM135689 US8846601, 74
US10179804, Example 75 BDBM135690 US10632171, Peptide No. 75 US9458201, 75 US8846601, 75
US10179804, Example 81 US9458201, 81 BDBM135696 US8846601, 81 US10632171, Peptide No. 81
US10179804, Example 85 US10632171, Peptide No. 85 US9458201, 85 BDBM135700 US8846601, 85
US10179804, Example 86 BDBM135701 US10632171, Peptide No. 86 US9458201, 86 US8846601, 86
US10179804, Example 91 US8846601, 91 US9458201, 91 BDBM135706 US10632171, Peptide No. 91
US10632171, Peptide No. 10 US10179804, Example 10 BDBM135625 US8846601, 10 US9458201, 10
US10632171, Peptide No. 108 US9458201, 108 US10179804, Example 108 BDBM135723 US8846601, 108
US10632171, Peptide No. 109 US9458201, 109 US10179804, Example 109 BDBM135724 US8846601, 109
US10632171, Peptide No. 11 US10179804, Example 11 BDBM135626 US8846601, 11 US9458201, 11
US10632171, Peptide No. 119 US9458201, 119 US10179804, Example 119 BDBM135734 US8846601, 119
US10632171, Peptide No. 12 US10179804, Example 12 US9458201, 12 BDBM135627 US8846601, 12
US10632171, Peptide No. 13 BDBM135628 US9458201, 13 US8846601, 13 US10179804, Example 13
US10632171, Peptide No. 14 BDBM135629 US8846601, 14 US10179804, Example 14 US9458201, 14
US10632171, Peptide No. 34 US10179804, Example 34 US9458201, 34 BDBM135649 US8846601, 34
US10632171, Peptide No. 35 BDBM135650 US9458201, 35 US8846601, 35 US10179804, Example 35
US10632171, Peptide No. 54 US10179804, Example 54 BDBM135669 US8846601, 54 US9458201, 54
US10632171, Peptide No. 56 BDBM135671 US10179804, Example 56 US9458201, 56 US8846601, 56
US10632171, Peptide No. 67 BDBM135682 US10179804, Example 67 US9458201, 67 US8846601, 67
US10632171, Peptide No. 7 US8846601, 7 US9458201, 7 US10179804, Example 7 BDBM135622
US10632171, Peptide No. 76 US10179804, Example 76 BDBM135691 US8846601, 76 US9458201, 76
US10632171, Peptide No. 77 BDBM135692 US10179804, Example 77 US8846601, 77 US9458201, 77
US10632171, Peptide No. 78 BDBM135693 US10179804, Example 78 US9458201, 78 US8846601, 78
US10632171, Peptide No. 8 US8846601, 8 US10179804, Example 8 US9458201, 8 BDBM135623
US10632171, Peptide No. 87 US10179804, Example 87 BDBM135702 US8846601, 87 US9458201, 87
US10632171, Peptide No. 88 US10179804, Example 88 BDBM135703 US8846601, 88 US9458201, 88
US10632171, Peptide No. 89 US10179804, Example 89 US9458201, 89 BDBM135704 US8846601, 89
US10632171, Peptide No. 99 US10179804, Example 99 BDBM135714 US8846601, 99 US9458201, 99
US8846601, 100 US10632171, Peptide No. 100 BDBM135715 US9458201, 100 US10179804, Example 100
US8846601, 110 US10632171, Peptide No. 110 US9458201, 110 BDBM135725 US10179804, Example 110
US8846601, 111 US10632171, Peptide No. 111 BDBM135726 US9458201, 111 US10179804, Example 111
US8846601, 112 US10632171, Peptide No. 112 BDBM135727 US9458201, 112 US10179804, Example 112
US8846601, 121 US10632171, Peptide No. 121 US9458201, 121 BDBM135736 US10179804, Example 121
US8846601, 123 US10632171, Peptide No. 123 BDBM135738 US9458201, 123 US10179804, Example 123
US8846601, 133 US10632171, Peptide No. 133 BDBM135748 US9458201, 133 US10179804, Example 133
US8846601, 143 US10632171, Peptide No. 143 US9458201, 143 BDBM135758 US10179804, Example 143
US8846601, 144 US10632171, Peptide No. 144 BDBM135759 US9458201, 144 US10179804, Example 144
US8846601, 150 US10632171, Peptide No. 150 US10179804, Example 150 US9458201, 150 BDBM135765
US8846601, 161 US10632171, Peptide No. 161 US10179804, Example 161 US9458201, 161 BDBM135776
US8846601, 18 US10632171, Peptide No. 18 US10179804, Example 18 BDBM135633 US9458201, 55
US8846601, 29 US9458201, 29 US10632171, Peptide No. 29 US10179804, Example 29 BDBM135644
US8846601, 4 US9458201, 4 US10632171, Peptide No. 4 BDBM135619 US10179804, Example 4
US8846601, 62 US9458201, 62 US10179804, Example 62 BDBM135677 US10632171, Peptide No. 62
US8846601, 73 US9458201, 73 US10179804, Example 73 BDBM135688 US10632171, Peptide No. 73
US8846601, 84 US9458201, 84 US10179804, Example 84 BDBM135699 US10632171, Peptide No. 84
US8846601, 90 US9458201, 90 BDBM135705 US10632171, Peptide No. 90 US10179804, Example 90
US9458201, 102 BDBM135717 US8846601, 102 US10632171, Peptide No. 102 US10179804, Example 102
US9458201, 103 BDBM135718 US8846601, 103 US10632171, Peptide No. 103 US10179804, Example 103
US9458201, 106 US10179804, Example 106 US8846601, 106 BDBM135721 US10632171, Peptide No. 106
US9458201, 107 US10179804, Example 107 US8846601, 107 BDBM135722 US10632171, Peptide No. 107
US9458201, 114 BDBM135729 US8846601, 114 US10632171, Peptide No. 114 US10179804, Example 114
US9458201, 118 US10179804, Example 118 US8846601, 118 BDBM135733 US10632171, Peptide No. 118
US9458201, 124 BDBM135739 US8846601, 124 US10632171, Peptide No. 124 US10179804, Example 124
US9458201, 128 US10179804, Example 128 US8846601, 128 BDBM135743 US10632171, Peptide No. 128
US9458201, 136 US10179804, Example 129 US8846601, 129 BDBM135744 US10632171, Peptide No. 129
US9458201, 139 US10179804, Example 139 US8846601, 139 BDBM135754 US10632171, Peptide No. 139
- Shiryaev, VA; Skomorohov, MY; Leonova, MV; Bormotov, NI; Serova, OA; Shishkina, LN; Agafonov, AP; Maksyutov, RA; Klimochkin, YN Adamantane derivatives as potential inhibitors of p37 major envelope protein and poxvirus reproduction. Design, synthesis and antiviral activity. Eur J Med Chem 221: (2021)
- WANG, EY; YU, H; WANG, KY; HE, J PEPTIDE UREA DERIVATIVE, PHARMACEUTICAL COMPOSITION CONTAINING PEPTIDE UREA DERIVATIVE, AND APPLICATION OF PEPTIDE UREA DERIVATIVE US Patent US20250108139 (2025)
- Miller, II, MM; Allen, MP; Li, L Cyclic peptide immunomodulators US Patent US11492375 (2022)
- Schteingart, CD; Menzaghi, F; Jiang, G; Alexander, RV; Sueiras-Diaz, J; Spencer, RH; Chalmers, DT; Luo, RZ Synthetic peptide amides US Patent US9359399 (2016)
- Bae, YS; Song, JY; Kim, Y; He, R; Ye, RD; Kwak, JY; Suh, PG; Ryu, SH Differential activation of formyl peptide receptor signaling by peptide ligands. Mol Pharmacol 64: 841-7 (2003)
- Stepniewski, TM; Filipek, S Non-peptide ligand binding to the formyl peptide receptor FPR2--A comparison to peptide ligand binding modes. Bioorg Med Chem 23: 4072-81 (2015)
- Wurtz, NR; Shirude, PS; Viet, AQ Piperidinone formyl peptide 2 receptor and formyl peptide 1 receptor agonists US Patent US11186544 (2021)
- WANG, T MACROCYCLIC PEPTIDE BORONATE IMMUNOMODULATORS US Patent US20230365627 (2023)
- Pitt, GR; Batt, AR; Haigh, RM; Penson, AM; Robson, PA; Rooker, DP; Tartar, AL; Trim, JE; Yea, CM; Roe, MB Non-peptide oxytocin agonists. Bioorg Med Chem Lett 14: 4585-9 (2004)
- Yamaguchi, T; Mori, Y; Saito, H; Kubota, H; Furukawa, A; Otsuka, E; Ishigai, Y; Ijiri, H; Reid, P Thrombospondin 1-binding peptide US Patent US11149066 (2021)
- Williams, TM; Stump, CA; Nguyen, DN; Quigley, AG; Bell, IM; Gallicchio, SN; Zartman, CB; Wan, BL; Penna, KD; Kunapuli, P; Kane, SA; Koblan, KS; Mosser, SD; Rutledge, RZ; Salvatore, C; Fay, JF; Vacca, JP; Graham, SL Non-peptide calcitonin gene-related peptide receptor antagonists from a benzodiazepinone lead. Bioorg Med Chem Lett 16: 2595-8 (2006)
- Lee, SK; Choi, KH; Lee, SJ; Lee, JS; Park, JY; Kim, BM; Lee, BJ Peptide deformylase inhibitors with non-peptide scaffold: synthesis and structure-activity relationships. Bioorg Med Chem Lett 21: 133-6 (2010)
- Daines, RA; Sham, KK; Taggart, JJ; Kingsbury, WD; Chan, J; Breen, A; Disa, J; Aiyar, N Quinine analogs as non-peptide calcitonin gene-related peptide (CGRP) receptor antagonists Bioorg Med Chem Lett 7: 2673-2676 (1997)
- Nishizawa, N; Nakamura, G; Noguchi, Y; Nakagawa, H; Shimizu, A; Nakayama, M; Takekawa, S; Asami, T A potent and selective natriuretic peptide receptor-3 blocker 11-mer peptide created by hybridization of musclin and atrial natriuretic peptide. Bioorg Med Chem Lett 27: 3542-3545 (2017)
- Pak, VV; Koo, M; Kwon, DY; Shakhidoyatov, KM; Yun, L Peptide fragmentation as an approach in modeling of an active peptide and designing a competitive inhibitory peptide for HMG-CoA reductase. Bioorg Med Chem 18: 4300-9 (2010)
- Shirude, PS; Chattopadhyay, AK; Wurtz, NR Aryl heterocyclic piperidinone formyl peptide 2 receptor and formyl peptide 1 receptor agonists US Patent US11124494 (2021)
- Peptide-Drug Conjugates: An Emerging Direction for the Next Generation of Peptide Therapeutics.
- BLEICHER, K; CHEANG, D; DI GIORGIO, P; HU, T; JENNY, C; MATTEI, P; SCHMITZ, P; STOLL, T PEPTIDE MACROCYCLES AGAINST ACINETOBACTER BAUMANNII US Patent US20240050516 (2024)
- Villain-Guillot, P; Gualtieri, M; Racine, E Peptide derivatives and uses thereof US Patent US10626144 (2020)
- Alanine, A; Beignet, J; Bleicher, K; Fasching, B; Hilpert, H; Hu, T; MacDonald, D; Jackson, S; Kolczewski, S; Kroll, C; Schaeublin, A; Shen, H; Stoll, T; Thomas, H; Wahhab, A; Zampaloni, C Peptide macrocycles against acinetobacter baumannii US Patent US10030047 (2018)
- Ashwood, V; Brownhill, V; Higginbottom, M; Horwell, DC; Hughes, J; Lewthwaite, RA; McKnight, AT; Pinnock, RD; Pritchard, MC; Suman-Chauhan, N; Webb, C; Williams, SC PD 176252--the first high affinity non-peptide gastrin-releasing peptide (BB2) receptor antagonist. Bioorg Med Chem Lett 8: 2589-94 (1999)
- WILLWACHER, J; BINDER, FP; DAHMANN, G; HANDSCHUH, SR; REINDL, SA; YANG HAMILTON, JY PHENYLPIPERIDINE DERIVATIVES AS INHIBITORS OF GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE AND GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE LIKE PROTEIN US Patent US20240246981 (2024)
- PIPERIDINYLBENZONITRILE DERIVATIVES AS INHIBITORS OF GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE AND GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE LIKE PROTEIN
- WILLWACHER, J; BINDER, FP; DAHMANN, G; YANG HAMILTON, JY; HANDSCHUH, SR; REINDL, SA PIPERIDINYLPYRIDINYLCARBONITRILE DERIVATIVES AS INHIBITORS OF GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE AND GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE LIKE PROTEIN US Patent US20240059675 (2024)
- Coombs, GS; Hazzard, J; Corey, DR Kinetic characterization of a peptide inhibitor of trypsin isolated from a synthetic peptide combinatorial library Bioorg Med Chem Lett 5: 611-614 (1995)
- Liao, S; Yang, J; Lv, J; Liao, Z; Zhou, H; Gao, J; Xie, T; Yang, Q; Wang, L; Ding, Z Kappa opioid receptor peptide amide ligands US Patent US12215173 (2025)
- Oyelere, AK; Chen, PC; Guerrant, W; Mwakwari, SC; Hood, R; Zhang, Y; Fan, Y Non-peptide macrocyclic histone deacetylase inhibitors. J Med Chem 52: 456-68 (2009)
- TANADA, M; TAKANO, K; MATSUO, A; TAMIYA, M; CHIYODA, A; ITO, T; IIDA, T; OHTA, A PHARMACEUTICAL USE OF CYCLIC PEPTIDE COMPOUND US Patent US20240148821 (2024)
- Shaw, A; Krell, RD Peptide leukotrienes: current status of research. J Med Chem 34: 1235-42 (1991)
- East, SP; Ayscough, A; Toogood-Johnson, I; Taylor, S; Thomas, W Peptidomimetic inhibitors of bacterial peptide deformylase. Bioorg Med Chem Lett 21: 4032-5 (2011)
- Shirude, PS; Baligar, V; Seshadri, B; Chattopadhyay, AK; Wurtz, NR; Kick, EK Phenylpyrrolidinone formyl peptide 2 receptor agonists US Patent US11117861 (2021)
- Shirude, PS; Chattopadhyay, AK; Rachamreddy, C; Wurtz, NR; Kick, EK Piperidinone formyl peptide 2 receptor agonists US Patent US11008301 (2021)
- Valentine, JJ; Nakanishi, S; Hageman, DL; Snider, R; Spencer, RW; Vinick, FJ CP-70,030 and CP-75,998: The first non-peptide antagonists of bombesin and gastrin releasing peptide Bioorg Med Chem Lett 2: 333-338 (1992)
- Haug, BE; Camilio, KA; Eliassen, LT; Stensen, W; Svendsen, JS; Berg, K; Mortensen, B; Serin, G; Mirjolet, JF; Bichat, F; Rekdal, Ø Discovery of a 9-mer Cationic Peptide (LTX-315) as a Potential First in Class Oncolytic Peptide. J Med Chem 59: 2918-27 (2016)
- Miranda, LP; Holder, JR; Shi, L; Bennett, B; Aral, J; Gegg, CV; Wright, M; Walker, K; Doellgast, G; Rogers, R; Li, H; Valladares, V; Salyers, K; Johnson, E; Wild, K Identification of potent, selective, and metabolically stable peptide antagonists to the calcitonin gene-related peptide (CGRP) receptor. J Med Chem 51: 7889-97 (2008)
- Xia, M; Sreedharan, SP; Bolin, DR; Gaufo, GO; Goetzl, EJ Novel cyclic peptide agonist of high potency and selectivity for the type II vasoactive intestinal peptide receptor. J Pharmacol Exp Ther 281: 629-33 (1997)
- Sugase, K; Oyama, Y; Kitano, K; Akutsu, H; Ishiguro, M Structure-activity relationships for mini atrial natriuretic peptide by proline-scanning mutagenesis and shortening of peptide backbone. Bioorg Med Chem Lett 12: 1245-7 (2002)
- Gebauer, S; Knütter, I; Hartrodt, B; Brandsch, M; Neubert, K; Thondorf, I Three-dimensional quantitative structure-activity relationship analyses of peptide substrates of the mammalian H+/peptide cotransporter PEPT1. J Med Chem 46: 5725-34 (2003)
- Bock, MG; DiPardo, RM; Veber, DF; Chang, RS; Lotti, VJ; Freedman, SB; Freidinger, RM Benzolactams as non-peptide cholecystokinin receptor ligands Bioorg Med Chem Lett 3: 871-874 (1993)
- Gomez-Monterrey, I; Sala, M; Rusciano, MR; Monaco, S; Maione, AS; Iaccarino, G; Tortorella, P; D'Ursi, AM; Scrima, M; Carotenuto, A; De Rosa, G; Bertamino, A; Vernieri, E; Grieco, P; Novellino, E; Illario, M; Campiglia, P Characterization of a selective CaMKII peptide inhibitor. Eur J Med Chem 62: 425-34 (2013)
- Barker, PL; Bullens, S; Bunting, S; Burdick, DJ; Chan, KS; Deisher, T; Eigenbrot, C; Gadek, TR; Gantzos, R; Lipari, MT Cyclic RGD peptide analogues as antiplatelet antithrombotics. J Med Chem 35: 2040-8 (1992)
- Kakizawa, T; Ota, Y; Itoh, Y; Tsumoto, H; Suzuki, T Histone H3 peptide based LSD1-selective inhibitors. Bioorg Med Chem Lett 25: 1925-8 (2015)
- DeCarr, LB; Buckholz, TM; Coish, PD; Fathi, Z; Fisk, SE; Mays, MR; O'Connor, SJ; Lumb, KJ Identification of selective neuropeptide Y2 peptide agonists. Bioorg Med Chem Lett 17: 538-41 (2007)
- Beard, RL; Duong, TT; Garst, ME Imidazole derivatives as formyl peptide receptor modulators US Patent US10800744 (2020)
- Evans, BE; Lundell, GF; Gilbert, KF; Bock, MG; Rittle, KE; Carroll, LA; Williams, PD; Pawluczyk, JM; Leighton, JL; Young, MB Nanomolar-affinity, non-peptide oxytocin receptor antagonists. J Med Chem 36: 3993-4005 (1994)
- Betz, SF; Zhu, YF; Chen, C; Struthers, RS Non-peptide gonadotropin-releasing hormone receptor antagonists. J Med Chem 51: 3331-48 (2008)
- Pacifico, S; Albanese, V; Illuminati, D; Marzola, E; Fabbri, M; Ferrari, F; Holanda, VAD; Sturaro, C; Malfacini, D; Ruzza, C; Trapella, C; Preti, D; Lo Cascio, E; Arcovito, A; Della Longa, S; Marangoni, M; Fattori, D; Nassini, R; Calò, G; Guerrini, R Novel Mixed NOP/Opioid Receptor Peptide Agonists. J Med Chem 64: 6656-6669 (2021)
- Hatcher, JM; Du, G; Fontán, L; Us, I; Qiao, Q; Chennamadhavuni, S; Shao, J; Wu, H; Melnick, A; Gray, NS; Scott, DA Peptide-based covalent inhibitors of MALT1 paracaspase. Bioorg Med Chem Lett 29: 1336-1339 (2019)
- Wójcik, P; Berlicki, L Peptide-based inhibitors of protein-protein interactions. Bioorg Med Chem Lett 26: 707-13 (2016)
- Harman, MAJ; Stanway, SJ; Scott, H; Demydchuk, Y; Bezerra, GA; Pellegrino, S; Chen, L; Brear, P; Lulla, A; Hyvönen, M; Beswick, PJ; Skynner, MJ Structure-Guided Chemical Optimization of Bicyclic Peptide ( J Med Chem 66: 9881-9893 (2023)
- Wang, Jx; Bray, AM; DiPasquale, AJ; Maeji, N; Geysen, H Application of the multipin peptide synthesis technique for peptide receptor binding studies: Substance P as A model system Bioorg Med Chem Lett 3: 447-450 (1993)
- Sandomenico, A; Russo, A; Palmieri, G; Bergamo, P; Gogliettino, M; Falcigno, L; Ruvo, M Small peptide inhibitors of acetyl-peptide hydrolase having an uncommon mechanism of inhibition and a stable bent conformation. J Med Chem 55: 2102-11 (2012)
- Blackburn, BK; Lee, A; Baier, M; Kohl, B; Olivero, AG; Matamoros, R; Robarge, KD; McDowell, RS From peptide to non-peptide. 3. Atropisomeric GPIIbIIIa antagonists containing the 3,4-dihydro-1H-1,4-benzodiazepine-2,5-dione nucleus. J Med Chem 40: 717-29 (1997)
- Askew, BC; McIntyre, CJ; Hunt, CA; Claremon, DA; Gould, RJ; Lynch, RJ; Armstrong, DJ Non-peptide glycoprotein IIb/IIIa inhibitors. 6. Design and synthesis of rigid, centrally constrained non-peptide fibrinogen receptor antagonists Bioorg Med Chem Lett 5: 475-480 (1995)
- Houghten, RA; Dooley, CT The use of synthetic peptide combinatorial libraries for the determination of peptide ligands in radio-receptor assays: Opioid peptides Bioorg Med Chem Lett 3: 405-412 (1993)
- Zhan, C; Zhao, L; Wei, X; Wu, X; Chen, X; Yuan, W; Lu, WY; Pazgier, M; Lu, W An ultrahigh affinity d-peptide antagonist Of MDM2. J Med Chem 55: 6237-41 (2012)
- Collins, JL; Dambek, PJ; Goldstein, SW; Faraci, W CP-99,711: a non-peptide glucagon receptor antagonist Bioorg Med Chem Lett 2: 915-918 (1992)
- Tilley, J; Kaplan, G; Fotouhi, N; Wolitzky, B; Rowan, K Carbacyclic peptide mimetics as VCAM-VLA-4 antagonists. Bioorg Med Chem Lett 10: 1163-5 (2000)
- Li, X; Craven, TW; Levine, PM Cyclic Peptide Screening Methods for Preclinical Drug Discovery. J Med Chem 65: 11913-11926 (2022)
- Li, X; Hong, D; Zhang, M; Xu, L; Zhou, Y; Li, J; Liu, T Development of peptide epoxyketones as selective immunoproteasome inhibitors. Eur J Med Chem 221: (2021)
- Saitoh, M; Takayama, K; Hitachi, K; Taguchi, A; Taniguchi, A; Tsuchida, K; Hayashi, Y Discovery of a follistatin-derived myostatin inhibitory peptide. Bioorg Med Chem Lett 30: (2020)
- Ng, HP; May, K; Bauman, JG; Ghannam, A; Islam, I; Liang, M; Horuk, R; Hesselgesser, J; Snider, RM; Perez, HD; Morrissey, MM Discovery of novel non-peptide CCR1 receptor antagonists. J Med Chem 42: 4680-94 (1999)
- Hu, YJ; Rajagopalan, PT; Pei, D H-phosphonate derivatives as novel peptide deformylase inhibitors. Bioorg Med Chem Lett 8: 2479-82 (1999)
- Molteni, V; He, X; Nabakka, J; Yang, K; Kreusch, A; Gordon, P; Bursulaya, B; Warner, I; Shin, T; Biorac, T; Ryder, NS; Goldberg, R; Doughty, J; He, Y Identification of novel potent bicyclic peptide deformylase inhibitors. Bioorg Med Chem Lett 14: 1477-81 (2004)
- Revesz, L; Blum, E; Manning, U; Demange, BJ; Widmer, A; Zuber, JF Non-peptide itam mimics as ZAP-70 antagonists Bioorg Med Chem Lett 7: 2875-2878 (1997)
- Kumaravel, G; Boettcher, BR; Shapiro, MJ; Petter, C Peptide mimics of glycylproline as inhibitors of prolidase Bioorg Med Chem Lett 5: 2825-2828 (1995)
- Pennington, MW; Czerwinski, A; Norton, RS Peptide therapeutics from venom: Current status and potential. Bioorg Med Chem 26: 2738-2758 (2018)
- Kortylewicz, ZP; Galardy, RE Phosphoramidate peptide inhibitors of human skin fibroblast collagenase. J Med Chem 33: 263-73 (1990)
- Blagg, J; Mowbray, C; Pryde, DC; Salmon, G; Schmid, E; Fairman, D; Beaumont, K Small, non-peptide C5a receptor antagonists: part 1. Bioorg Med Chem Lett 18: 5601-4 (2008)
- Blagg, J; Mowbray, C; Pryde, D; Salmon, G; Fairman, D; Schmid, E; Beaumont, K Small, non-peptide C5a receptor antagonists: part 2. Bioorg Med Chem Lett 18: 5605-8 (2008)
- Armour, DR; Watson, SP; Pegg, NA; Heron, NM; Middlemiss, D; Chan, C; Cholerton, TJ; Hubbard, T; Vinader, MV; Davies, HG; Cocker, JD; Bays, DE; Ward, P Spiro-piperidine non-peptide neurokinin-1 receptor antagonists Bioorg Med Chem Lett 5: 2671-2676 (1995)
- Yang, D; Qin, W; Shi, X; Zhu, B; Xie, M; Zhao, H; Teng, B; Wu, Y; Zhao, R; Yin, F; Ren, P; Liu, L; Li, Z Stabilized β-Hairpin Peptide Inhibits Insulin Degrading Enzyme. J Med Chem 61: 8174-8185 (2018)
- McGrath, ME; Sprengeler, PA; Hirschbein, B; Somoza, JR; Lehoux, I; Janc, JW; Gjerstad, E; Graupe, M; Estiarte, A; Venkataramani, C; Liu, Y; Yee, R; Ho, JD; Green, MJ; Lee, CS; Liu, L; Tai, V; Spencer, J; Sperandio, D; Katz, BA Structure-guided design of peptide-based tryptase inhibitors. Biochemistry 45: 5964-73 (2006)
- Douty, BD; Salvino, JM; Seoane, PR; Dolle, RE Synthesis of non-peptide bradykinin B2 receptor antagonists Bioorg Med Chem Lett 5: 363-366 (1995)
- Snider, RM; Pereira, DA; Longo, KP; Davidson, RE; Vinick, FJ; Laitinen, K; Genc-Sehitoglu, E; Crawley, JN UK-73,093: A non-peptide neurotensin receptor antagonist Bioorg Med Chem Lett 2: 1535-1540 (1992)
- Klein, MA; Mayo, KH; Kratzke, RA p16(INK4a) Peptide mimetics identified via virtual screening. Bioorg Med Chem Lett 20: 403-5 (2010)
- Lavecchia, A; Cosconati, S; Novellino, E Architecture of the human urotensin II receptor: comparison of the binding domains of peptide and non-peptide urotensin II agonists. J Med Chem 48: 2480-92 (2005)
- Pak, VV; Koo, M; Kim, MJ; Yun, L; Kwon, DY Binding effect and design of a competitive inhibitory peptide for HMG-CoA reductase through modeling of an active peptide backbone. Bioorg Med Chem 16: 1309-18 (2008)
- Askew, BC; Bednar, RA; Bednar, B; Claremon, DA; Cook, JJ; McIntyre, CJ; Hunt, CA; Gould, RJ; Lynch, RJ; Lynch, JJ; Gaul, SL; Stranieri, MT; Sitko, GR; Holahan, MA; Glass, JD; Hamill, T; Gorham, LM; Prueksaritanont, T; Baldwin, JJ; Hartman, GD Non-peptide glycoprotein IIb/IIIa inhibitors. 17. Design and synthesis of orally active, long-acting non-peptide fibrinogen receptor antagonists. J Med Chem 40: 1779-88 (1997)
- Machon, U; Büchold, C; Stempka, M; Schirmeister, T; Gelhaus, C; Leippe, M; Gut, J; Rosenthal, PJ; Kisker, C; Leyh, M; Schmuck, C On-bead screening of a combinatorial fumaric acid derived peptide library yields antiplasmodial cysteine protease inhibitors with unusual peptide sequences. J Med Chem 52: 5662-72 (2009)
- Gademann, K; Kimmerlin, T; Hoyer, D; Seebach, D Peptide folding induces high and selective affinity of a linear and small beta-peptide to the human somatostatin receptor 4. J Med Chem 44: 2460-8 (2001)
- Bech, EM; Martos-Maldonado, MC; Wismann, P; Sørensen, KK; van Witteloostuijn, SB; Thygesen, MB; Vrang, N; Jelsing, J; Pedersen, SL; Jensen, KJ Peptide Half-Life Extension: Divalent, Small-Molecule Albumin Interactions Direct the Systemic Properties of Glucagon-Like Peptide 1 (GLP-1) Analogues. J Med Chem 60: 7434-7446 (2017)
- Haugaard-Kedström, LM; Clemmensen, LS; Sereikaite, V; Jin, Z; Fernandes, EFA; Wind, B; Abalde-Gil, F; Daberger, J; Vistrup-Parry, M; Aguilar-Morante, D; Leblanc, R; Egea-Jimenez, AL; Albrigtsen, M; Jensen, KE; Jensen, TMT; Ivarsson, Y; Vincentelli, R; Hamerlik, P; Andersen, JH; Zimmermann, P; Lee, W; Strømgaard, K A High-Affinity Peptide Ligand Targeting Syntenin Inhibits Glioblastoma. J Med Chem 64: 1423-1434 (2021)
- Osher, EL; Castillo, F; Elumalai, N; Waring, MJ; Pairaudeau, G; Tavassoli, A A genetically selected cyclic peptide inhibitor of BCL6 homodimerization. Bioorg Med Chem 26: 3034-3038 (2018)
- Cappelli, A; Giuliani, G; Pericot Mohr Gl, G; Gallelli, A; Anzini, M; Vomero, S; Cupello, A; Scarrone, S; Matarrese, M; Moresco, RM; Fazio, F; Finetti, F; Morbidelli, L; Ziche, M A non-peptide NK1 receptor agonist showing subpicomolar affinity. J Med Chem 47: 1315-8 (2004)
- Knütter, I; Theis, S; Hartrodt, B; Born, I; Brandsch, M; Daniel, H; Neubert, K A novel inhibitor of the mammalian peptide transporter PEPT1. Biochemistry 40: 4454-8 (2001)
- Nishizawa, N; Kanematsu-Yamaki, Y; Funata, M; Nagai, H; Shimizu, A; Fujita, H; Sakamoto, J; Takekawa, S; Asami, T A potent neuromedin U receptor 2-selective alkylated peptide. Bioorg Med Chem Lett 27: 4626-4629 (2017)
- Koehler, MF; Zobel, K; Beresini, MH; Caris, LD; Combs, D; Paasch, BD; Lazarus, RA Albumin affinity tags increase peptide half-life in vivo. Bioorg Med Chem Lett 12: 2883-6 (2002)
- Beard, DJ; Perrine, SA; Phillips, E; Hoque, S; Conerly, S; Tichenor, C; Simmons, MA; Young, JK Conformational comparisons of a series of tachykinin peptide analogs. J Med Chem 50: 6501-6 (2007)
- Fotouhi, N; Joshi, P; Tilley, JW; Rowan, K; Schwinge, V; Wolitzky, B Cyclic thioether peptide mimetics as VCAM-VLA-4 antagonists. Bioorg Med Chem Lett 10: 1167-9 (2000)
- Granger, BA; Brown, DG Design and synthesis of peptide-based macrocyclic cyclophilin inhibitors. Bioorg Med Chem Lett 26: 5304-5307 (2016)
- Haberman, VA; Fleming, SR; Leisner, TM; Puhl, AC; Feng, E; Xie, L; Chen, X; Goto, Y; Suga, H; Parise, LV; Kireev, D; Pearce, KH; Bowers, AA Discovery and Development of Cyclic Peptide Inhibitors of CIB1. ACS Med Chem Lett 12: 1832-1839 (2021)
- Heimbrook, DC; Saari, WS; Balishin, NL; Fisher, TW; Friedman, A; Kiefer, DM; Rotberg, NS; Wallen, JW; Oliff, A Gastrin releasing peptide antagonists with improved potency and stability. J Med Chem 34: 2102-7 (1991)
- Harrison, JG; Frier, C; Laurant, R; Dennis, R; Raney, KD; Balasubramanian, S Inhibition of human telomerase by PNA-cationic peptide conjugates. Bioorg Med Chem Lett 9: 1273-8 (1999)
- Tang, KF; Abdullah, MP; Yusoff, K; Tan, WS Interactions of hepatitis B core antigen and peptide inhibitors. J Med Chem 50: 5620-6 (2007)
- Tan, C; Gao, Y; Kaur, J; Cooperman, BS More potent linear peptide inhibitors of mammalian ribonucleotide reductase. Bioorg Med Chem Lett 14: 5301-4 (2004)
- Pallandre, JR; Borg, C; Rognan, D; Boibessot, T; Luzet, V; Yesylevskyy, S; Ramseyer, C; Pudlo, M Novel aminotetrazole derivatives as selective STAT3 non-peptide inhibitors. Eur J Med Chem 103: 163-74 (2015)
- Moinet, C; Contour-Galcéra, MO; Poitout, L; Morgan, B; Gordon, T; Rouber, P; Thurieau, C Novel non-peptide ligands for the somatostatin sst3 receptor. Bioorg Med Chem Lett 11: 991-5 (2001)
- East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M Peptide deformylase inhibitors with activity against respiratory tract pathogens. Bioorg Med Chem Lett 14: 59-62 (2003)
- Saito, R; Pruet, JM; Manzano, LA; Jasheway, K; Monzingo, AF; Wiget, PA; Kamat, I; Anslyn, EV; Robertus, JD Peptide-conjugated pterins as inhibitors of ricin toxin A. J Med Chem 56: 320-9 (2013)
- Kruijtzer, JA; Nijenhuis, WA; Wanders, N; Gispen, WH; Liskamp, RM; Adan, RA Peptoid-peptide hybrids as potent novel melanocortin receptor ligands. J Med Chem 48: 4224-30 (2005)
- Inokuchi, E; Oishi, S; Kubo, T; Ohno, H; Shimura, K; Matsuoka, M; Fujii, N Potent CXCR4 antagonists containing amidine type Peptide bond isosteres. ACS Med Chem Lett 2: 477-480 (2011)
- CHEN, S; YANG, Y; ZHANG, J; LI, P; HE, H; WANG, Z; LI, J RING-MODIFIED PROLINE SHORT PEPTIDE COMPOUND AND USE THEREOF US Patent US20230312571 (2023)
- Qin, Y Synthesis of peptide borate ester compound and use thereof US Patent US11542283 (2023)
- Han, LQ; Yuan, X; Wu, XY; Li, RD; Xu, B; Cheng, Q; Liu, ZM; Zhou, TY; An, HY; Wang, X; Cheng, TM; Ge, ZM; Cui, JR; Li, RT Urea-containing peptide boronic acids as potent proteasome inhibitors. Eur J Med Chem 125: 925-939 (2017)
- Bunker, AM; Edmunds, JJ; Berryman, KA; Walker, DM; Flynn, MA; Welch, KM; Doherty, AM 1,3-diaryl-2-carboxyindoles as potent non-peptide endothelin antagonists Bioorg Med Chem Lett 6: 1061-1066 (1996)
- Yamazaki, K; Terauchi, H; Iida, D; Fukumoto, H; Suzuki, S; Kagaya, T; Aoki, M; Koyama, K; Seiki, T; Takase, K; Watanabe, M; Arai, T; Tsukahara, K; Nagakawa, J Ago-allosteric modulators of human glucagon-like peptide 2 receptor. Bioorg Med Chem Lett 22: 6126-35 (2012)
- Fuselier, JA; Sun, L; Woltering, SN; Murphy, WA; Vasilevich, N; Coy, DH An adjustable release rate linking strategy for cytotoxin-peptide conjugates. Bioorg Med Chem Lett 13: 799-803 (2003)
- Pratt, LM; Beckett, RP; Davies, SJ; Launchbury, SB; Miller, A; Spavold, ZM; Todd, RS; Whittaker, M Asymmetric synthesis of BB-3497--a potent peptide deformylase inhibitor. Bioorg Med Chem Lett 11: 2585-8 (2001)
- Mercer, SE; Chaturvedula, PV; Conway, CM; Cook, DA; Davis, CD; Pin, SS; Macci, R; Schartman, R; Signor, LJ; Widmann, KA; Whiterock, VJ; Chen, P; Xu, C; Herbst, JJ; Kostich, WA; Thalody, G; Macor, JE; Dubowchik, GM Azepino-indazoles as calcitonin gene-related peptide (CGRP) receptor antagonists. Bioorg Med Chem Lett 31: (2021)
- Tal-Gan, Y; Hurevich, M; Klein, S; Ben-Shimon, A; Rosenthal, D; Hazan, C; Shalev, DE; Niv, MY; Levitzki, A; Gilon, C Backbone cyclic peptide inhibitors of protein kinase B (PKB/Akt). J Med Chem 54: 5154-64 (2011)
- Angelini, A; Morales-Sanfrutos, J; Diderich, P; Chen, S; Heinis, C Bicyclization and tethering to albumin yields long-acting peptide antagonists. J Med Chem 55: 10187-97 (2012)
- Brain-Permeable Immunoproteasome-Targeting Macrocyclic Peptide Epoxyketones for Alzheimer's Disease.
- Fournel, S; Wieckowski, S; Sun, W; Trouche, N; Dumortier, H; Bianco, A; Chaloin, O; Habib, M; Peter, JC; Schneider, P; Vray, B; Toes, RE; Offringa, R; Melief, CJ; Hoebeke, J; Guichard, G C3-symmetric peptide scaffolds are functional mimetics of trimeric CD40L. Nat Chem Biol 1: 377-82 (2005)
- Erchegyi, J; Wang, L; Gulyas, J; Samant, M; Perrin, MH; Lewis, K; Miller, C; Vaughan, J; Donaldson, C; Fischer, W; Low, W; Yakabi, S; Karasawa, H; Taché, Y; Rivier, C; Rivier, J Characterization of Multisubstituted Corticotropin Releasing Factor (CRF) Peptide Antagonists (Astressins). J Med Chem 59: 854-66 (2016)
- Evans, BE; Rittle, KE; Bock, MG; DiPardo, RM; Freidinger, RM; Whitter, WL; Gould, NP; Lundell, GF; Homnick, CF; Veber, DF Design of nonpeptidal ligands for a peptide receptor: cholecystokinin antagonists. J Med Chem 30: 1229-39 (1987)
- Stilz, HU; Jablonka, B; Just, M; Knolle, J; Paulus, EF; Zoller, G Discovery of an orally active non-peptide fibrinogen receptor antagonist. J Med Chem 39: 2118-22 (1996)
- Durroux, T; Peter, M; Turcatti, G; Chollet, A; Balestre, MN; Barberis, C; Seyer, R Fluorescent pseudo-peptide linear vasopressin antagonists: design, synthesis, and applications. J Med Chem 42: 1312-9 (1999)
- Jacobsson, E; Peigneur, S; Andersson, HS; Laborde, Q; Strand, M; Tytgat, J; Göransson, U Functional Characterization of the Nemertide α Family of Peptide Toxins. J Nat Prod 84: 2121-2128 (2021)
- Dolle, RE; Michaut, M; Martinez-Teipel, B; Belanger, S; Graczyk, TM; DeHaven, RN Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg Med Chem Lett 17: 2656-60 (2007)
- Garcia-Calvo, M; Peterson, EP; Leiting, B; Ruel, R; Nicholson, DW; Thornberry, NA Inhibition of human caspases by peptide-based and macromolecular inhibitors. J Biol Chem 273: 32608-13 (1998)
- Zhao, L; O'Reilly, MK; Shultz, MD; Chmielewski, J Interfacial peptide inhibitors of HIV-1 integrase activity and dimerization. Bioorg Med Chem Lett 13: 1175-7 (2003)
- Duggan, PJ; Lewis, RJ; Phei Lok, Y; Lumsden, NG; Tuck, KL; Yang, A Low molecular weight non-peptide mimics of omega-conotoxin GVIA. Bioorg Med Chem Lett 19: 2763-5 (2009)
- Peyman, A; Stahl, W; Wagner, K; Ruppert, D; Budt, KH Non-peptide-based inhibitors of human immunodeficiency virus-1 protease Bioorg Med Chem Lett 4: 2601-2604 (1994)
- Gupta, A; Gomes, I; Wardman, J; Devi, LA Opioid receptor function is regulated by post-endocytic peptide processing. J Biol Chem 289: 19613-26 (2014)
- Priestley, ES; De Lucca, I; Ghavimi, B; Erickson-Viitanen, S; Decicco, CP P1 Phenethyl peptide boronic acid inhibitors of HCV NS3 protease. Bioorg Med Chem Lett 12: 3199-202 (2002)
- Yu, H; Wang, EY; Wang, KY PEPTIDE-UREA DERIVATIVE, PHARMACEUTICAL COMPOSITION CONTAINING SAME AND APPLICATION THEREOF US Patent US20240366813 (2024)
- Suzuki, S; Urano, E; Hashimoto, C; Tsutsumi, H; Nakahara, T; Tanaka, T; Nakanishi, Y; Maddali, K; Han, Y; Hamatake, M; Miyauchi, K; Pommier, Y; Beutler, JA; Sugiura, W; Fuji, H; Hoshino, T; Itotani, K; Nomura, W; Narumi, T; Yamamoto, N; Komano, JA; Tamamura, H Peptide HIV-1 integrase inhibitors from HIV-1 gene products. J Med Chem 53: 5356-60 (2010)
- Lynagh, T; Kiontke, S; Meyhoff-Madsen, M; Gless, BH; Johannesen, J; Kattelmann, S; Christiansen, A; Dufva, M; Laustsen, AH; Devkota, K; Olsen, CA; Kümmel, D; Pless, SA; Lohse, B Peptide Inhibitors of the α-Cobratoxin-Nicotinic Acetylcholine Receptor Interaction. J Med Chem 63: 13709-13718 (2020)
- Gordon, T; Hansen, P; Morgan, B; Singh, J; Baizman, E; Ward, S Peptide azoles: A new class of biologically-active dipeptide mmetics. Bioorg Med Chem Lett 3: 915-920 (1993)
- Einsiedel, J; Hübner, H; Hervet, M; Härterich, S; Koschatzky, S; Gmeiner, P Peptide backbone modifications on the C-terminal hexapeptide of neurotensin. Bioorg Med Chem Lett 18: 2013-8 (2008)
- Yin, Z; Patel, SJ; Wang, WL; Wang, G; Chan, WL; Rao, KR; Alam, J; Jeyaraj, DA; Ngew, X; Patel, V; Beer, D; Lim, SP; Vasudevan, SG; Keller, TH Peptide inhibitors of Dengue virus NS3 protease. Part 1: Warhead. Bioorg Med Chem Lett 16: 36-9 (2005)
- Llinàs-Brunet, M; Bailey, M; Fazal, G; Goulet, S; Halmos, T; Laplante, S; Maurice, R; Poirier, M; Poupart, MA; Thibeault, D; Wernic, D; Lamarre, D Peptide-based inhibitors of the hepatitis C virus serine protease. Bioorg Med Chem Lett 8: 1713-8 (1999)
- Steel, RJ; O'Connell, MA; Searcey, M Perfluoroarene-based peptide macrocycles that inhibit the Nrf2/Keap1 interaction. Bioorg Med Chem Lett 28: 2728-2731 (2018)
- Josef, KA; Kauer, FW; Bihovsky, R Potent peptide alpha-ketohydroxamate inhibitors of recombinant human calpain I. Bioorg Med Chem Lett 11: 2615-7 (2001)
- Gaeta, FC; Lehman de Gaeta, LS; Kogan, TP; Or, YS; Foster, C; Czarniecki, M Small peptide inhibitors of smooth muscle myosin light chain kinase. J Med Chem 33: 964-72 (1990)
- Knudsen, LB; Kiel, D; Teng, M; Behrens, C; Bhumralkar, D; Kodra, JT; Holst, JJ; Jeppesen, CB; Johnson, MD; de Jong, JC; Jorgensen, AS; Kercher, T; Kostrowicki, J; Madsen, P; Olesen, PH; Petersen, JS; Poulsen, F; Sidelmann, UG; Sturis, J; Truesdale, L; May, J; Lau, J Small-molecule agonists for the glucagon-like peptide 1 receptor. Proc Natl Acad Sci U S A 104: 937-42 (2007)
- Salvino, JM; Seoane, PR; Douty, BD; Awad, MA; Hoyer, D; Ross, TM; Dolle, RE; Houck, WT; Faunce, DM; Sawutz, DG Structure activity relationships of non-peptide bradykinin B2 receptor antagonists Bioorg Med Chem Lett 5: 357-362 (1995)
- Hu, X; Nguyen, KT; Verlinde, CL; Hol, WG; Pei, D Structure-based design of a macrocyclic inhibitor for peptide deformylase. J Med Chem 46: 3771-4 (2003)
- Iqbal, M; Messina, PA; Freed, B; Das, M; Chatterjee, S; Tripathy, R; Tao, M; Josef, KA; Dembofsky, B; Dunn, D; Griffith, E; Siman, R; Senadhi, SE; Biazzo, W; Bozyczko-Coyne, D; Meyer, SL; Ator, MA; Bihovsky, R Subsite requirements for peptide aldehyde inhibitors of human calpain I Bioorg Med Chem Lett 7: 539-544 (1997)
- Buzder-Lantos, P; Bockstael, K; Anné, J; Herdewijn, P Substrate based peptide aldehyde inhibits bacterial type I signal peptidase. Bioorg Med Chem Lett 19: 2880-3 (2009)
- Koskinen, AM; Valo, T; Vihavainen, S; Hakala, JM Synthesis of -helix substituted analogs of calcitonin gene-related peptide Bioorg Med Chem Lett 5: 573-578 (1995)
- Sgrignani, J; Cecchinato, V; Fassi, EMA; D'Agostino, G; Garofalo, M; Danelon, G; Pedotti, M; Simonelli, L; Varani, L; Grazioso, G; Uguccioni, M; Cavalli, A Systematic Development of Peptide Inhibitors Targeting the CXCL12/HMGB1 Interaction. J Med Chem 64: 13439-13450 (2021)
- Lumangtad, LA; Bell, TW The signal peptide as a new target for drug design. Bioorg Med Chem Lett 30: (2020)
- Takayama, K; Mori, K; Tanaka, A; Sasaki, Y; Sohma, Y; Taguchi, A; Taniguchi, A; Sakane, T; Yamamoto, A; Miyazato, M; Minamino, N; Kangawa, K; Hayashi, Y A chemically stable peptide agonist to neuromedin U receptor type 2. Bioorg Med Chem 28: (2020)
- Pepanian, A; Binbay, FA; Roy, S; Nubbemeyer, B; Koley, A; Rhodes, CA; Ammer, H; Pei, D; Ghosh, P; Imhof, D Bicyclic Peptide Library Screening for the Identification of Gαi Protein Modulators. J Med Chem 66: 12396-12406 (2023)
- Martin, C; Dumitrascuta, M; Mannes, M; Lantero, A; Bucher, D; Walker, K; Van Wanseele, Y; Oyen, E; Hernot, S; Van Eeckhaut, A; Madder, A; Hoogenboom, R; Spetea, M; Ballet, S Biodegradable Amphipathic Peptide Hydrogels as Extended-Release System for Opioid Peptides. J Med Chem 61: 9784-9789 (2018)
- Luo, G; Chen, L; Pin, SS; Xu, C; Conway, CM; Macor, JE; Dubowchik, GM Calcitonin gene-related peptide (CGRP) receptor antagonists: novel aspartates and succinates. Bioorg Med Chem Lett 22: 2912-6 (2012)
- Bell, IM Calcitonin gene-related peptide receptor antagonists: new therapeutic agents for migraine. J Med Chem 57: 7838-58 (2014)
- Valiente, PA; Wen, H; Nim, S; Lee, J; Kim, HJ; Kim, J; Perez-Riba, A; Paudel, YP; Hwang, I; Kim, KD; Kim, S; Kim, PM Computational Design of Potent D-Peptide Inhibitors of SARS-CoV-2. J Med Chem 64: 14955-14967 (2021)
- Nagahara, T; Saitoh, T; Kutsumura, N; Irukayama-Tomobe, Y; Ogawa, Y; Kuroda, D; Gouda, H; Kumagai, H; Fujii, H; Yanagisawa, M; Nagase, H Design and Synthesis of Non-Peptide, Selective Orexin Receptor 2 Agonists. J Med Chem 58: 7931-7 (2015)
- Hu, F; Chou, CJ; Gottesfeld, JM Design and synthesis of novel hybrid benzamide-peptide histone deacetylase inhibitors. Bioorg Med Chem Lett 19: 3928-31 (2009)
- Chen, D; Shi, J; Liu, J; Zhang, X; Deng, X; Yang, Y; Cui, S; Zhu, Q; Gong, G; Xu, Y Design, synthesis and antithrombotic evaluation of novel non-peptide thrombin inhibitors. Bioorg Med Chem 25: 458-470 (2017)
- Bryan, WM; Hempel, JC; Huffman, WF; Marshall, GR; Moore, ML; Silvestri, J; Stassen, FL; Stefankiewicz, JS; Sulat, L; Webb, RL Design, synthesis, and biological activity of a peptide mimic of vasopressin. J Med Chem 31: 742-4 (1988)
- Tan, KT; Guiu-Rozas, E; Bon, RS; Guo, Z; Delon, C; Wetzel, S; Arndt, S; Alexandrov, K; Waldmann, H; Goody, RS; Wu, YW; Blankenfeldt, W Design, synthesis, and characterization of peptide-based rab geranylgeranyl transferase inhibitors. J Med Chem 52: 8025-37 (2009)
- Fetse, J; Zhao, Z; Liu, H; Mamani, UF; Mustafa, B; Adhikary, P; Ibrahim, M; Liu, Y; Patel, P; Nakhjiri, M; Alahmari, M; Li, G; Cheng, K Discovery of Cyclic Peptide Inhibitors Targeting PD-L1 for Cancer Immunotherapy. J Med Chem 65: 12002-12013 (2022)
- Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR Discovery of Heteroaryl Urea Isosteres for Formyl Peptide Receptor 2 Agonists. ACS Med Chem Lett 13: 943-948 (2022)
- López, LC; Dos-Reis, S; Espargaró, A; Carrodeguas, JA; Maddelein, ML; Ventura, S; Sancho, J Discovery of novel inhibitors of amyloid β-peptide 1-42 aggregation. J Med Chem 55: 9521-30 (2012)
- Patil, NA; Hughes, RA; Rosengren, KJ; Kocan, M; Ang, SY; Tailhades, J; Separovic, F; Summers, RJ; Grosse, J; Wade, JD; Bathgate, RA; Hossain, MA Engineering of a Novel Simplified Human Insulin-Like Peptide 5 Agonist. J Med Chem 59: 2118-25 (2016)
- Ja, WW; West, AP; Delker, SL; Bjorkman, PJ; Benzer, S; Roberts, RW Extension of Drosophila melanogaster life span with a GPCR peptide inhibitor. Nat Chem Biol 3: 415-9 (2007)
- Perlman, ZE; Bock, JE; Peterson, JR; Lokey, RS Geometric diversity through permutation of backbone configuration in cyclic peptide libraries. Bioorg Med Chem Lett 15: 5329-34 (2005)
- Apfel, C; Banner, DW; Bur, D; Dietz, M; Hirata, T; Hubschwerlen, C; Locher, H; Page, MG; Pirson, W; Rossé, G; Specklin, JL Hydroxamic acid derivatives as potent peptide deformylase inhibitors and antibacterial agents. J Med Chem 43: 2324-31 (2000)
- Choi, WJ; Kim, SE; Stephen, AG; Weidlich, I; Giubellino, A; Liu, F; Worthy, KM; Bindu, L; Fivash, MJ; Nicklaus, MC; Bottaro, DP; Fisher, RJ; Burke, TR Identification of Shc Src homology 2 domain-binding peptoid-peptide hybrids. J Med Chem 52: 1612-8 (2009)
- Poitout, L; Roubert, P; Contour-Galcéra, MO; Moinet, C; Lannoy, J; Pommier, J; Plas, P; Bigg, D; Thurieau, C Identification of potent non-peptide somatostatin antagonists with sst(3) selectivity. J Med Chem 44: 2990-3000 (2001)
- Aeed, PA; Young, CL; Nagiec, MM; Elhammer, AP Inhibition of inositol phosphorylceramide synthase by the cyclic peptide aureobasidin A. Antimicrob Agents Chemother 53: 496-504 (2009)
- Olsen, CA; Montero, A; Leman, LJ; Ghadiri, MR Macrocyclic peptoid-Peptide hybrids as inhibitors of class I histone deacetylases. ACS Med Chem Lett 3: 749-753 (2012)
- Yoo, JS; Zheng, CJ; Lee, S; Kwak, JH; Kim, WG Macrolactin N, a new peptide deformylase inhibitor produced by Bacillus subtilis. Bioorg Med Chem Lett 16: 4889-92 (2006)
- Durek, T; Kaas, Q; White, AM; Weidmann, J; Fuaad, AA; Cheneval, O; Schroeder, CI; de Veer, SJ; Dellsén, A; Österlund, T; Larsson, N; Knerr, L; Bauer, U; Plowright, AT; Craik, DJ Melanocortin 1 Receptor Agonists Based on a Bivalent, Bicyclic Peptide Framework. J Med Chem 64: 9906-9915 (2021)
- Giuliani, G; Cappelli, A; Matarrese, M; Masiello, V; Turolla, EA; Monterisi, C; Fazio, F; Anzini, M; Pericot Mohr, G; Riitano, D; Finetti, F; Morbidelli, L; Ziche, M; Giorgi, G; Vomero, S Non-peptide NK1 receptor ligands based on the 4-phenylpyridine moiety. Bioorg Med Chem 19: 2242-51 (2011)
- Krovat, EM; Langer, T Non-peptide angiotensin II receptor antagonists: chemical feature based pharmacophore identification. J Med Chem 46: 716-26 (2003)
- Ronsisvalle, G; Pasquinucci, L; Pappalardo, MS; Vittorio, F; Fronza, G; Romagnoli, C; Pistacchio, E; Spampinato, S; Ferri, S Non-peptide ligands for opioid receptors. Design of kappa-specific agonists. J Med Chem 36: 1860-5 (1993)
- Mwakwari, SC; Guerrant, W; Patil, V; Khan, SI; Tekwani, BL; Gurard-Levin, ZA; Mrksich, M; Oyelere, AK Non-peptide macrocyclic histone deacetylase inhibitors derived from tricyclic ketolide skeleton. J Med Chem 53: 6100-11 (2010)
- Patel, KD; De Zoysa, GH; Kanamala, M; Patel, K; Pilkington, LI; Barker, D; Reynisson, J; Wu, Z; Sarojini, V Novel Cell-Penetrating Peptide Conjugated Proteasome Inhibitors: Anticancer and Antifungal Investigations. J Med Chem 63: 334-348 (2020)
- Dal Pozzo, A; Ni, MH; Esposito, E; Dallavalle, S; Musso, L; Bargiotti, A; Pisano, C; Vesci, L; Bucci, F; Castorina, M; Foderà, R; Giannini, G; Aulicino, C; Penco, S Novel tumor-targeted RGD peptide-camptothecin conjugates: synthesis and biological evaluation. Bioorg Med Chem 18: 64-72 (2010)
- Kok, ZY; Stoddart, LA; Mistry, SJ; Mocking, TAM; Vischer, HF; Leurs, R; Hill, SJ; Mistry, SN; Kellam, B Optimization of Peptide Linker-Based Fluorescent Ligands for the Histamine H J Med Chem 65: 8258-8288 (2022)
- Knerr, PJ; Finan, B; Gelfanov, V; Perez-Tilve, D; Tschöp, MH; DiMarchi, RD Optimization of peptide-based polyagonists for treatment of diabetes and obesity. Bioorg Med Chem 26: 2873-2881 (2018)
- Attwood, MR; Conway, EA; Dunsdon, RM; Greening, JR; Handa, BK; Jones, PS; Jordan, SC; Keech, E; Wilson, FX Peptide based inhibitors of interleukin-8: structural simplification and enhanced potency Bioorg Med Chem Lett 7: 429-432 (1997)
- Ku, TW; Miller, WH; Bondinell, WE; Erhard, KF; Keenan, RM; Nichols, AJ; Peishoff, CE; Samanen, JM; Wong, AS; Huffman, WF Potent non-peptide fibrinogen receptor antagonists which present an alternative pharmacophore. J Med Chem 38: 9-12 (1995)
- Tora, G; Degnan, AP; Conway, CM; Kostich, WA; Davis, CD; Pin, SS; Schartman, R; Xu, C; Widmann, KA; Macor, JE; Dubowchik, GM Preparation of imidazoles as potent calcitonin gene-related peptide (CGRP) antagonists. Bioorg Med Chem Lett 23: 5684-8 (2013)
- Mroz, PA; Perez-Tilve, D; Liu, F; Gelfanov, V; DiMarchi, RD; Mayer, JP Pyridyl-alanine as a Hydrophilic, Aromatic Element in Peptide Structural Optimization. J Med Chem 59: 8061-7 (2016)
- Fisher, A; Yang, FD; Rubin, H; Cooperman, BS R2 C-terminal peptide inhibition of mammalian and yeast ribonucleotide reductase. J Med Chem 36: 3859-62 (1994)
- Talma, M; Maślanka, M; Mucha, A Recent developments in the synthesis and applications of phosphinic peptide analogs. Bioorg Med Chem Lett 29: 1031-1042 (2019)
- Reichart, F; Maltsev, OV; Kapp, TG; Räder, AFB; Weinmüller, M; Marelli, UK; Notni, J; Wurzer, A; Beck, R; Wester, HJ; Steiger, K; Di Maro, S; Di Leva, FS; Marinelli, L; Nieberler, M; Reuning, U; Schwaiger, M; Kessler, H Selective Targeting of Integrin αvβ8 by a Highly Active Cyclic Peptide. J Med Chem 62: 2024-2037 (2019)
- Iben, LG; Olson, RE; Balanda, LA; Jayachandra, S; Robertson, BJ; Hay, V; Corradi, J; Prasad, CV; Zaczek, R; Albright, CF; Toyn, JH Signal peptide peptidase and gamma-secretase share equivalent inhibitor binding pharmacology. J Biol Chem 282: 36829-36 (2007)
- Joshi, AA; Murray, TF; Aldrich, JV Structure-Activity Relationships of the Peptide Kappa Opioid Receptor Antagonist Zyklophin. J Med Chem 58: 8783-95 (2015)
- Marastoni, M; Salvadori, S; Balboni, G; Borea, PA; Marzola, G; Tomatis, R Synthesis and activity profiles of new dermorphin-(1-4) peptide analogues. J Med Chem 30: 1538-42 (1987)
- Qiu, Z; Yan, M; Li, Q; Liu, D; Van den Steen, PE; Wang, M; Opdenakker, G; Hu, J Definition of peptide inhibitors from a synthetic peptide library by targeting gelatinase B/matrix metalloproteinase-9 (MMP-9) and TNF-a converting enzyme (TACE/ADAM-17). J Enzyme Inhib Med Chem 27: 533-40 (2012)
- Boteju, LW; Zalewska, T; Yamamura, HI; Hruby, VJ Tryptophan-norleucine 1,5-disubstituted tetrazoles as cis peptide bond mimics: Investigation of the bioactive conformation of a potent and selective peptide for the cholecystokinin-B receptor Bioorg Med Chem Lett 3: 2011-2016 (1993)
- Boeglin, D; Hamdan, FF; Melendez, RE; Cluzeau, J; Laperriere, A; Héroux, M; Bouvier, M; Lubell, WD Calcitonin gene-related peptide analogues with aza and indolizidinone amino acid residues reveal conformational requirements for antagonist activity at the human calcitonin gene-related peptide 1 receptor. J Med Chem 50: 1401-8 (2007)
- Porter, RA; Chan, WN; Coulton, S; Johns, A; Hadley, MS; Widdowson, K; Jerman, JC; Brough, SJ; Coldwell, M; Smart, D; Jewitt, F; Jeffrey, P; Austin, N 1,3-Biarylureas as selective non-peptide antagonists of the orexin-1 receptor. Bioorg Med Chem Lett 11: 1907-10 (2001)
- Bunker, AM; Edmunds, JJ; Berryman, KA; Walker, DM; Flynn, MA; Welch, KM; Doherty, AM 1-benzyl-3-thioaryl-2-carboxyindoles as potent non-peptide endothelin antagonists Bioorg Med Chem Lett 6: 1367-1370 (1996)
- Tait, BD; Hagen, S; Domagala, J; Ellsworth, EL; Gajda, C; Hamilton, HW; Prasad, JV; Ferguson, D; Graham, N; Hupe, D; Nouhan, C; Tummino, PJ; Humblet, C; Lunney, EA; Pavlovsky, A; Rubin, J; Gracheck, SJ; Baldwin, ET; Bhat, TN; Erickson, JW; Gulnik, SV; Liu, B 4-hydroxy-5,6-dihydropyrones. 2. Potent non-peptide inhibitors of HIV protease. J Med Chem 40: 3781-92 (1997)
- Gallagher, EE; Menon, A; Chmiel, AF; Deprey, K; Kritzer, JA; Garner, AL A cell-penetrant lactam-stapled peptide for targeting eIF4E protein-protein interactions. Eur J Med Chem 205: (2020)
- Liu, D; Yang, B; Cao, R; Huang, Z A chemical strategy to promote helical peptide-protein interactions involved in apoptosis. Bioorg Med Chem Lett 15: 4467-9 (2005)
- Guarise, C; Ceradini, D; Tessari, M; Pavan, M; Moro, S; Salmaso, V; Barbera, C; Beninatto, R; Galesso, D Amphiphilic peptide-based MMP3 inhibitors for intra-articular treatment of knee OA. Bioorg Med Chem 38: (2021)
- Spinnler, K; von Krüchten, L; Konieczny, A; Schindler, L; Bernhardt, G; Keller, M An Alkyne-functionalized Arginine for Solid-Phase Synthesis Enabling "Bioorthogonal" Peptide Conjugation. ACS Med Chem Lett 11: 334-339 (2020)
- Kottirsch, G; Zerwes, HG; Cook, NS; Tapparelli, C Beta-amino acid derivatives as orally active non-peptide fibrinogen receptor antagonists Bioorg Med Chem Lett 7: 727-732 (1997)
- Mollica, A; Pinnen, F; Costante, R; Locatelli, M; Stefanucci, A; Pieretti, S; Davis, P; Lai, J; Rankin, D; Porreca, F; Hruby, VJ Biological active analogues of the opioid peptide biphalin: mixeda/ß(3)-peptides. J Med Chem 56: 3419-23 (2013)
- Nguyen, DN; Paone, DV; Shaw, AW; Burgey, CS; Mosser, SD; Johnston, V; Salvatore, CA; Leonard, YM; Miller-Stein, CM; Kane, SA; Koblan, KS; Vacca, JP; Graham, SL; Williams, TM Calcitonin gene-related peptide (CGRP) receptor antagonists: investigations of a pyridinone template. Bioorg Med Chem Lett 18: 755-8 (2008)
- Degnan, AP; Conway, CM; Dalterio, RA; Macci, R; Mercer, SE; Schartman, R; Xu, C; Dubowchik, GM; Macor, JE Carbamates as potent calcitonin gene-related peptide antagonists with improved solution stability. Bioorg Med Chem Lett 19: 3555-8 (2009)
- Hossain, MA; Bathgate, RAD Challenges in the design of insulin and relaxin/insulin-like peptide mimetics. Bioorg Med Chem 26: 2827-2841 (2018)
- Thakkar, R; Upreti, D; Ishiguro, S; Tamura, M; Comer, J Computational design of a cyclic peptide that inhibits the CTLA4 immune checkpoint. RSC Med Chem 14: 658-670 (2023)
- Hegde, VR; Puar, MS; Dai, P; Patel, M; Gullo, VP; Chan, TM; Silver, J; Pramanik, BN; Jenh, CH Condensed aromatic peptide family of microbial metabolites, inhibitors of CD28-CD80 interactions. Bioorg Med Chem Lett 13: 573-5 (2003)
- Wang, Z; Chen, L; Bayly, SF; Torrence, PF Convergent synthesis of ribonuclease L-active 2',5'-oligoadenylate-peptide nucleic acids. Bioorg Med Chem Lett 10: 1357-60 (2000)
- Luo, Q; Ma, Y; Liang, H; Feng, Y; Liu, N; Lian, C; Zhu, L; Ye, Y; Liu, Z; Hou, Z; Chen, S; Wang, Y; Dai, C; Song, C; Zhang, M; He, Z; Xing, Y; Zhong, W; Li, S; Wu, J; Lu, F; Yin, F; Li, Z Covalent Peptide LSD1 Inhibitor Specifically Recognizes Cys360 in the Enzyme-Active Region. J Med Chem 66: 15409-15423 (2023)
- Chen, D; Zheng, W Cyclic peptide-based potent and selective SIRT1/2 dual inhibitors harboring N Bioorg Med Chem Lett 26: 5234-5239 (2016)
- Duggineni, S; Mitra, S; Lamberto, I; Han, X; Xu, Y; An, J; Pasquale, EB; Huang, Z Design and Synthesis of Potent Bivalent Peptide Agonists Targeting the EphA2 Receptor. ACS Med Chem Lett 4: 344-8 (2013)
- Menzler, S; Bikker, JA; Suman-Chauhan, N; Horwell, DC Design and biological evaluation of non-peptide analogues of omega-conotoxin MVIIA. Bioorg Med Chem Lett 10: 345-7 (2000)
- Zhang, X; Schmitt, AC; Jiang, W; Wasserman, Z; Decicco, CP Design and synthesis of potent, non-peptide inhibitors of HCV NS3 protease. Bioorg Med Chem Lett 13: 1157-60 (2003)
- Wang, C; McFadyen, IJ; Traynor, JR; Mosberg, HI Design of a high affinity peptidomimetic opioid agonist from peptide pharmacophore models. Bioorg Med Chem Lett 8: 2685-8 (1999)
- Evans, BE; Bock, MG; Rittle, KE; DiPardo, RM; Whitter, WL; Veber, DF; Anderson, PS; Freidinger, RM Design of potent, orally effective, nonpeptidal antagonists of the peptide hormone cholecystokinin. Proc Natl Acad Sci U S A 83: 4918-22 (1986)
- Bursavich, MG; Rich, DH Designing non-peptide peptidomimetics in the 21st century: inhibitors targeting conformational ensembles. J Med Chem 45: 541-58 (2002)
- Chatenet, D; Folch, B; Feytens, D; Létourneau, M; Tourwé, D; Doucet, N; Fournier, A Development and pharmacological characterization of conformationally constrained urotensin II-related peptide agonists. J Med Chem 56: 9612-22 (2014)
- Adams, GL; Pall, PS; Grauer, SM; Zhou, X; Ballard, JE; Vavrek, M; Kraus, RL; Morissette, P; Li, N; Colarusso, S; Bianchi, E; Palani, A; Klein, R; John, CT; Wang, D; Tudor, M; Nolting, AF; Biba, M; Nowak, T; Makarov, AA; Reibarkh, M; Buevich, AV; Zhong, W; Regalado, EL; Wang, X; Gao, Q; Shahripour, A; Zhu, Y; de Simone, D; Frattarelli, T; Pasquini, NM; Magotti, P; Iaccarino, R; Li, Y; Solly, K; Lee, KJ; Wang, W; Chen, F; Zeng, H; Wang, J; Regan, H; Amin, RP; Regan, CP; Burgey, CS; Henze, DA; Sun, C; Tellers, DM Development of ProTx-II Analogues as Highly Selective Peptide Blockers of Na J Med Chem 65: 485-496 (2022)
- Jian, M; Sun, X; Cheng, G; Zhang, H; Li, X; Song, F; Liu, Z; Wang, Z Discovery of Phenolic Matrix Metalloproteinase Inhibitors by Peptide Microarray for Osteosarcoma Treatment. J Nat Prod 85: 2424-2432 (2022)
- Boehm, M; Beaumont, K; Jones, R; Kalgutkar, AS; Zhang, L; Atkinson, K; Bai, G; Brown, JA; Eng, H; Goetz, GH; Holder, BR; Khunte, B; Lazzaro, S; Limberakis, C; Ryu, S; Shapiro, MJ; Tylaska, L; Yan, J; Turner, R; Leung, SSF; Ramaseshan, M; Price, DA; Liras, S; Jacobson, MP; Earp, DJ; Lokey, RS; Mathiowetz, AM; Menhaji-Klotz, E Discovery of Potent and Orally Bioavailable Macrocyclic Peptide-Peptoid Hybrid CXCR7 Modulators. J Med Chem 60: 9653-9663 (2017)
- Hoekstra, WJ; Patel, HS; Liang, X; Blanc, JB; Heyer, DO; Willson, TM; Iannone, MA; Kadwell, SH; Miller, LA; Pearce, KH; Simmons, CA; Shearin, J Discovery of novel quinoline-based estrogen receptor ligands using peptide interaction profiling. J Med Chem 48: 2243-7 (2005)
- Wang, S; Milne, GW; Yan, X; Posey, IJ; Nicklaus, MC; Graham, L; Rice, WG Discovery of novel, non-peptide HIV-1 protease inhibitors by pharmacophore searching. J Med Chem 39: 2047-54 (1996)
- Mapelli, C; Natarajan, SI; Meyer, JP; Bastos, MM; Bernatowicz, MS; Lee, VG; Pluscec, J; Riexinger, DJ; Sieber-McMaster, ES; Constantine, KL; Smith-Monroy, CA; Golla, R; Ma, Z; Longhi, DA; Shi, D; Xin, L; Taylor, JR; Koplowitz, B; Chi, CL; Khanna, A; Robinson, GW; Seethala, R; Antal-Zimanyi, IA; Stoffel, RH; Han, S; Whaley, JM; Huang, CS; Krupinski, J; Ewing, WR Eleven amino acid glucagon-like peptide-1 receptor agonists with antidiabetic activity. J Med Chem 52: 7788-99 (2009)
- Harrison, RES; Zewde, NT; Narkhede, YB; Hsu, RV; Morikis, D; Vullev, VI; Palermo, G Factor H-Inspired Design of Peptide Biomarkers of the Complement C3d Protein. ACS Med Chem Lett 11: 1054-1059 (2020)
- Röver, S; Adam, G; Cesura, AM; Galley, G; Jenck, F; Monsma, FJ; Wichmann, J; Dautzenberg, FM High-affinity, non-peptide agonists for the ORL1 (orphanin FQ/nociceptin) receptor. J Med Chem 43: 1329-38 (2001)
- Itoh, Y; Aihara, K; Mellini, P; Tojo, T; Ota, Y; Tsumoto, H; Solomon, VR; Zhan, P; Suzuki, M; Ogasawara, D; Shigenaga, A; Inokuma, T; Nakagawa, H; Miyata, N; Mizukami, T; Otaka, A; Suzuki, T Identification of SNAIL1 Peptide-Based Irreversible Lysine-Specific Demethylase 1-Selective Inactivators. J Med Chem 59: 1531-44 (2016)
- Odagami, T; Tsuda, Y; Kogami, Y; Kouji, H; Okada, Y Identification of new agonists of urotensin-II from a cyclic peptide library. Bioorg Med Chem 17: 6742-7 (2009)
- Ueda, S; Kato, M; Inuki, S; Ohno, H; Evans, B; Wang, ZX; Peiper, SC; Izumi, K; Kodama, E; Matsuoka, M; Nagasawa, H; Oishi, S; Fujii, N Identification of novel non-peptide CXCR4 antagonists by ligand-based design approach. Bioorg Med Chem Lett 18: 4124-9 (2008)
- Rao, RC; Gal, CS; Granger, I; Gleye, J; Augereau, JM; Bessibes, C Khusimol, a Non-Peptide Ligand for Vasopressin V1a Receptors J Nat Prod 57: 1329-1335 (1994)
- Smith, PW; Cooper, AW; Bell, R; Beresford, IJ; Gore, PM; McElroy, AB; Pritchard, JM; Saez, V; Taylor, NR; Sheldrick, RL New spiropiperidines as potent and selective non-peptide tachykinin NK2 receptor antagonists. J Med Chem 38: 3772-9 (1995)
- Kalindjian, SB; Buck, IM; Davies, JM; Dunstone, DJ; Hudson, ML; Low, CM; McDonald, IM; Pether, MJ; Steel, KI; Tozer, MJ; Vinter, JG Non-peptide cholecystokinin-B/gastrin receptor antagonists based on bicyclic, heteroaromatic skeletons. J Med Chem 39: 1806-15 (1996)
- Klein, SI; Molino, BF; Czekaj, M; Dener, JS; Leadley, RJ; Sabatino, R; Dunwiddie, CT; Chu, V Non-peptide fibrinogen receptor antagonists based upon a 4-substituted piperidine scaffold Bioorg Med Chem Lett 6: 1403-1408 (1996)
- Hartman, GD; Egbertson, MS; Halczenko, W; Laswell, WL; Duggan, ME; Smith, RL; Naylor, AM; Manno, PD; Lynch, RJ; Zhang, G Non-peptide fibrinogen receptor antagonists. 1. Discovery and design of exosite inhibitors. J Med Chem 35: 4640-2 (1993)
- Hobbs, DW; Gould, NP; Hoffman, JB; Clineschmidt, BV; Pettibone, DJ; Veber, DF; Freidinger, RM Non-peptide oxytocin antagonists: identification and synthesis of a potent camphor aminosuccinimide Bioorg Med Chem Lett 5: 119-122 (1995)
- Pichota, A; Duraiswamy, J; Yin, Z; Keller, TH; Alam, J; Liung, S; Lee, G; Ding, M; Wang, G; Chan, WL; Schreiber, M; Ma, I; Beer, D; Ngew, X; Mukherjee, K; Nanjundappa, M; Teo, JW; Thayalan, P; Yap, A; Dick, T; Meng, W; Xu, M; Koehn, J; Pan, SH; Clark, K; Xie, X; Shoen, C; Cynamon, M Peptide deformylase inhibitors of Mycobacterium tuberculosis: synthesis, structural investigations, and biological results. Bioorg Med Chem Lett 18: 6568-72 (2008)
- Lee, SK; Choi, KH; Lee, SJ; Suh, SW; Kim, BM; Lee, BJ Peptide deformylase inhibitors with retro-amide scaffold: synthesis and structure-activity relationships. Bioorg Med Chem Lett 20: 4317-9 (2010)
- Schmidt, BF; Hernandez, L; Rouzer, C; Czerwinski, G; Chmurny, G; Michejda, CJ Peptide-linked 1,3-dialkyl-3-acyltriazenes: gastrin receptor directed antineoplastic alkylating agents. J Med Chem 37: 3812-8 (1994)
- Jackson, DY; Quan, C; Artis, DR; Rawson, T; Blackburn, B; Struble, M; Fitzgerald, G; Chan, K; Mullins, S; Burnier, JP; Fairbrother, WJ; Clark, K; Berisini, M; Chui, H; Renz, M; Jones, S; Fong, S Potent alpha 4 beta 1 peptide antagonists as potential anti-inflammatory agents. J Med Chem 40: 3359-68 (1997)
- Engström, M; Brandt, A; Wurster, S; Savola, JM; Panula, P Prolactin releasing peptide has high affinity and efficacy at neuropeptide FF2 receptors. J Pharmacol Exp Ther 305: 825-32 (2003)
- Herrero, S; Suarez-Gea, M; Gonzalez-Muniz, R; Garcia-Lopez, M; Herranz, R; Ballaz, S; Barber, A; Fortuno, A; Del Rio, J Pseudopeptide CCK-4 analogues incorporating the [CH(CN)NH] peptide bond surrogate Bioorg Med Chem Lett 7: 855-860 (1997)
- Ulysse, LG; Chmielewski, J Restricting the flexibility of crosslinked, interfacial peptide inhibitors of HIV-1 protease. Bioorg Med Chem Lett 8: 3281-6 (1999)
- Shomin, CD; Restituyo, E; Cox, KJ; Ghosh, I Selection of cyclic-peptide inhibitors targeting Aurora kinase A: problems and solutions. Bioorg Med Chem 19: 6743-9 (2011)
- Zhou, J; Li, Y; Huang, W; Shi, W; Qian, H Source and exploration of the peptides used to construct peptide-drug conjugates. Eur J Med Chem 224: (2021)
- Ly, HD; Clugston, SL; Sampson, PB; Honek, JF Syntheses and kinetic evaluation of hydroxamate-based peptide inhibitors of glyoxalase I. Bioorg Med Chem Lett 8: 705-10 (1999)
- Pacifico, S; Ferretti, V; Albanese, V; Fantinati, A; Gallerani, E; Nicoli, F; Gavioli, R; Zamberlan, F; Preti, D; Marastoni, M Synthesis and Biological Activity of Peptide α-Ketoamide Derivatives as Proteasome Inhibitors. ACS Med Chem Lett 10: 1086-1092 (2019)
- Schiller, PW; Nguyen, TM; Lemieux, C; Maziak, LA Synthesis and activity profiles of novel cyclic opioid peptide monomers and dimers. J Med Chem 28: 1766-71 (1986)
- Roark, WH; Tinney, FJ; Cohen, D; Essenburg, AD; Kaplan, HR Synthesis and biological activity of modified peptide inhibitors of angiotensin-converting enzyme. J Med Chem 28: 1291-5 (1985)
- Liu, XW; Ma, J; Colson, AO; Doersen, DC; Ebetino, FH Synthesis and biological activity of novel peptide mimetics as melanocortin receptor agonists. Bioorg Med Chem Lett 18: 1223-8 (2008)
- Han, L; Wen, Y; Li, R; Xu, B; Ge, Z; Wang, X; Cheng, T; Cui, J; Li, R Synthesis and biological activity of peptide proline-boronic acids as proteasome inhibitors. Bioorg Med Chem 25: 4031-4044 (2017)
- Horwell, DC; Howson, W; Ratcliffe, GS; Rees, DC The design of a dipeptide library for screening at peptide receptor sites Bioorg Med Chem Lett 3: 799-802 (1993)
- Viswanath, V; Beard, RL; Donello, JE; Hsia, E Use of agonists of formyl peptide receptor 2 for treating dermatological diseases US Patent US10434112 (2019)
- Sugihara, H; Fukushi, H; Miyawaki, T; Imai, Y; Terashita, Z; Kawamura, M; Fujisawa, Y; Kita, S Novel non-peptide fibrinogen receptor antagonists. 1. Synthesis and glycoprotein IIb-IIIa antagonistic activities of 1,3,4-trisubstituted 2-oxopiperazine derivatives incorporating side-chain functions of the RGDF peptide. J Med Chem 41: 489-502 (1998)
- Griffith, DA; Edmonds, DJ; Fortin, JP; Kalgutkar, AS; Kuzmiski, JB; Loria, PM; Saxena, AR; Bagley, SW; Buckeridge, C; Curto, JM; Derksen, DR; Dias, JM; Griffor, MC; Han, S; Jackson, VM; Landis, MS; Lettiere, D; Limberakis, C; Liu, Y; Mathiowetz, AM; Patel, JC; Piotrowski, DW; Price, DA; Ruggeri, RB; Tess, DA A Small-Molecule Oral Agonist of the Human Glucagon-like Peptide-1 Receptor. J Med Chem 65: 8208-8226 (2022)
- Gallop, MA; Barrett, RW; Dower, WJ; Fodor, SP; Gordon, EM Applications of combinatorial technologies to drug discovery. 1. Background and peptide combinatorial libraries. J Med Chem 37: 1233-51 (1994)
- Song, Y; Jin, H; Liu, X; Zhu, L; Huang, J; Li, H Discovery of non-peptide inhibitors of Plasmepsin II by structure-based virtual screening. Bioorg Med Chem Lett 23: 2078-82 (2013)
- Matsumoto, M; Nomura, T; Momose, K; Ikeda, Y; Kondou, Y; Akiho, H; Togami, J; Kimura, Y; Okada, M; Yamaguchi, T Inactivation of a novel neuropeptide Y/peptide YY receptor gene in primate species. J Biol Chem 271: 27217-20 (1996)
- Zobel, K; Koehler, MF; Beresini, MH; Caris, LD; Combs, D Phosphate ester serum albumin affinity tags greatly improve peptide half-life in vivo. Bioorg Med Chem Lett 13: 1513-5 (2003)
- Emonds-Alt, X; Bichon, D; Ducoux, JP; Heaulme, M; Miloux, B; Poncelet, M; Proietto, V; Van Broeck, D; Vilain, P; Neliat, G SR 142801, the first potent non-peptide antagonist of the tachykinin NK3 receptor. Life Sci 56: -32 (1995)