Affinity DataIC50: 6nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 11nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 11nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 12nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Nankai University
Curated by ChEMBL
Nankai University
Curated by ChEMBL
Affinity DataIC50: 13nMAssay Description:Inhibition of recombinant full-length human CDK4/cyclinD3 using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scint...More data for this Ligand-Target Pair
Affinity DataIC50: 15nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 25nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 33nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 34nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 42nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 50nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 68nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Homo sapiens (Human))
Nankai University
Curated by ChEMBL
Nankai University
Curated by ChEMBL
Affinity DataIC50: 71nMAssay Description:Inhibition of recombinant full-length human CDK6/cyclinD3 using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scinti...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Homo sapiens (Human))
Nankai University
Curated by ChEMBL
Nankai University
Curated by ChEMBL
Affinity DataIC50: 145nMAssay Description:Inhibition of recombinant full-length human CDK6/cyclinD3 using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scinti...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Nankai University
Curated by ChEMBL
Nankai University
Curated by ChEMBL
Affinity DataIC50: 148nMAssay Description:Inhibition of recombinant full-length human CDK4/cyclinD3 using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scint...More data for this Ligand-Target Pair
Affinity DataIC50: 197nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair