Compile Data Set for Download or QSAR
maximum 50k data
Found 43 of affinity data for UniProtKB/TrEMBL: Q15375
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50345579(5-((5-(4-((4-(2-hydroxyethyl)piperazin-1-yl)methyl...)
Affinity DataIC50:  4.20nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] peptide substrate by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  39.2nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  56.3nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  143nMAssay Description:Inhibition of human recombinant EPHA7 (613 to 909 residues) using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC incubated for 40 mins in presence of [gamma...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50605159(CHEMBL5195469)
Affinity DataIC50:  162nMAssay Description:Inhibition of human wild type partial length EphA7 (Y608 to S912 residues) expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50466038(CHEMBL4281823)
Affinity DataIC50:  190nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate after 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50563891(CHEMBL4793380)
Affinity DataIC50:  199nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in prese...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50271212(CHEMBL3715238)
Affinity DataIC50:  665nMAssay Description:Inhibition of recombinant GST-tagged human EphA7 cytoplasmic domain expressed in baculovirus expression system by FRET assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM13533(1-[2-(4-methylphenyl)-5-tert-butyl-pyrazol-3-yl]-3...)
Affinity DataIC50: <1.00E+3nMAssay Description:Concentration required to inhibit the phosphorylation of a 14-residue fragment of phospholipase C gamma 1 by Epidermal growth factor receptor from A4...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50244430(9-(2,6-dimethylstyryl)-N-(4-(dimethylphosphoryl)ph...)
Affinity DataIC50: >1.00E+3nMAssay Description:Inhibition of EphA1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50299218(8-(2-Methoxyphenyl)-1-methyl-7-(2'-methyl-5'-hydro...)
Affinity DataIC50:  1.12E+3nMAssay Description:Inhibition of EphA7 by [gamma33-P]ATP based assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50519662(CHEMBL4438748)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate measured after 40 mins in presence of [gamma33ATP] by ra...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM4814(CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fl...)
Affinity DataKd:  960nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM21(CHEMBL24828 | N-(4-bromo-2-fluorophenyl)-6-methoxy...)
Affinity DataKd:  50nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM21079(1-[4-(3-amino-1H-indazol-4-yl)phenyl]-3-(2-fluoro-...)
Affinity DataKd:  110nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM31085(1-[4-[(4-ethyl-1-piperazinyl)methyl]-3-(trifluorom...)
Affinity DataKd:  1.10E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM13533(1-[2-(4-methylphenyl)-5-tert-butyl-pyrazol-3-yl]-3...)
Affinity DataKd:  860nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM5446(CHEMBL553 | ERLOTINIB HYDROCHLORIDE | Erlotinib | ...)
Affinity DataKd:  1.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM6866(1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b ...)
Affinity DataKd:  3.10E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM31093(4-[[7-[2,6-bis(fluoranyl)phenyl]-9-chloranyl-5H-py...)
Affinity DataKd:  1.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM16673(4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamo...)
Affinity DataKd:  5.30E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM31096(CHEMBL290084 | Staurosporine | cid_451705)
Affinity DataKd:  630nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM4814(CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fl...)
Affinity DataKd:  2.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM21(CHEMBL24828 | N-(4-bromo-2-fluorophenyl)-6-methoxy...)
Affinity DataKd:  2.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50368452(CHEMBL4168305)
Affinity DataKd:  200nMAssay Description:Binding affinity to human EPHA7More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50505542(CHEMBL4576489)
Affinity DataKd:  887nMAssay Description:Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 in...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50505541(CHEMBL4465866)
Affinity DataKd:  766nMAssay Description:Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 in...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50551644(CHEMBL4745937)
Affinity DataEC50:  3.26E+3nMAssay Description:Inhibition of human EPHA7 incubated for 30 mins by Kinobead based assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM31096(CHEMBL290084 | Staurosporine | cid_451705)
Affinity DataKd:  290nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM16673(4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamo...)
Affinity DataKd:  370nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM31095(5-[(Z)-(5-fluoranyl-2-oxidanylidene-1H-indol-3-yli...)
Affinity DataKd:  2.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM13336(4-[4-(4-fluorophenyl)-2-(4-methanesulfinylphenyl)-...)
Affinity DataKd:  1.20E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM13531(4-(4-Fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridy...)
Affinity DataKd:  2.20E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM31093(4-[[7-[2,6-bis(fluoranyl)phenyl]-9-chloranyl-5H-py...)
Affinity DataKd:  580nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM5447(CHEMBL939 | GEFITINIB | Iressa | N-(3-Chloro-4-flu...)
Affinity DataKd:  590nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM5446(CHEMBL553 | ERLOTINIB HYDROCHLORIDE | Erlotinib | ...)
Affinity DataKd:  440nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM4779(CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib ...)
Affinity DataKd:  270nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM31088(1-methyl-5-[2-[5-(trifluoromethyl)-1H-imidazol-2-y...)
Affinity DataKd:  1.50E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM13533(1-[2-(4-methylphenyl)-5-tert-butyl-pyrazol-3-yl]-3...)
Affinity DataKd:  2.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM31085(1-[4-[(4-ethyl-1-piperazinyl)methyl]-3-(trifluorom...)
Affinity DataKd:  380nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM21079(1-[4-(3-amino-1H-indazol-4-yl)phenyl]-3-(2-fluoro-...)
Affinity DataKd:  330nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Ariad Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM24773(AMG 706 | AMG-706 | Motesanib | N-(3,3-dimethyl-1,...)
Affinity DataKd:  490nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails PCBioAssay