Compile Data Set for Download or QSAR
maximum 50k data
Found 3311 of ic50 for UniProtKB: P50750
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50454441(CHEMBL4217448)
Affinity DataIC50:  0.400nMAssay Description:Inhibition of N-terminal GST-HIS6 fusion protein tagged human full length CDK9 (M1 to F372 residues)/N-terminal GST-HIS6 fusion protein tagged human ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605617(US11673893, Example 86)
Affinity DataIC50:  0.406nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605531((1S,3R)-N-(5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  0.416nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605532((1S,3R)-N-(5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  0.455nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605523((1S,3R)-N-[5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  0.477nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605596(US11673893, Example 65)
Affinity DataIC50:  0.480nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605534((1S,3R)-N-(5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  0.489nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605533((1S,3R)-N-(5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  0.498nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50553495(CHEMBL4786559)
Affinity DataIC50: <0.5nMAssay Description:Displacement of Alexa Fluor 647 ADP Tracer from His-tagged human CDK9/Cyclin T1 expressed in baculovirus expression system incubated for 1 hr by adap...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM642569(US20230416221, Compound 96)
Affinity DataIC50:  0.520nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605526((1S,3R)-N-(5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  0.528nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605551((1S,3R)-3-acetamido-N-(4-(4-fluoro-1-isopropyl-1H-...)
Affinity DataIC50:  0.539nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM7533((2R)-2-[[6-(benzylamino)-9-isopropyl-purin-2-yl]am...)
Affinity DataIC50: >0.600nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605549((1S,3R)-3-acetamido-N-(4-(4-fluoro-1-isopropyl-1H-...)
Affinity DataIC50:  0.694nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605525((1S,3R)-N-(5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  0.699nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50564820(CHEMBL4785212)
Affinity DataIC50:  0.700nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605573(US11673893, Example 45)
Affinity DataIC50:  0.743nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605529(N-[(1R,3S)-3-[[5-chloro-4-(7-fluoro-3-isopropyl-2-...)
Affinity DataIC50:  0.760nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605606(US11673893, Example 76-1)
Affinity DataIC50:  0.780nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605528((1S,3R)-N-[5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  0.794nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605581(US11673893, Example 53)
Affinity DataIC50:  0.820nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605618(US11673893, Example 87)
Affinity DataIC50:  0.837nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM642551(US20230416221, Compound 27)
Affinity DataIC50:  0.890nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM642572(US20230416221, Compound 104)
Affinity DataIC50:  0.900nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605604(US11673893, Example 74)
Affinity DataIC50:  0.938nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605592(US11673893, Example 62)
Affinity DataIC50:  0.961nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605571(US11673893, Example 43)
Affinity DataIC50:  0.979nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605530(N-((1R,3S)-3-((5-chloro-4-(7-fluoro-3-isopropyl-2-...)
Affinity DataIC50:  0.980nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605572(US11673893, Example 44)
Affinity DataIC50:  0.984nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM601953(2'-((4-(piperazine-1- carbonyl)phenyl)amino)-7',8'...)
Affinity DataIC50:  1nMAssay Description:Selected compounds disclosed herein were tested in kinase assays by Nanosyn (Santa Clara, Calif.) to determine their inhibitory effect on these CDKs....More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM187124(US9670161, 5 N-{6-(Difluoromethyl)-4-[(methylsulfo...)
Affinity DataIC50:  1nMpH: 8.0Assay Description:Recombinant full-length His-tagged human CDK9 and CycT1, expressed in insect cells and purified by Ni-NTA affinity chromatography, were purchase from...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50193093(RGB-286638)
Affinity DataIC50:  1nMAssay Description:Inhibition of CDK9/cyclin T1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50193103(CHEMBL3957795)
Affinity DataIC50:  1nMAssay Description:Inhibition of human recombinant full length His-tagged CDK9/cyclin T1 expressed in insect cells using biotin-Ttds-YISPLKSPYKISEG as substrate preincu...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50193096(CHEMBL3977324)
Affinity DataIC50:  1nMAssay Description:Inhibition of CDK9/cyclin T1 (unknown origin) using cdk7tide peptide as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50454379(CHEMBL4205123)
Affinity DataIC50:  1nMAssay Description:Inhibition of N-terminal GST-HIS6 fusion protein tagged human full length CDK9 (M1 to F372 residues)/N-terminal GST-HIS6 fusion protein tagged human ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50466210(CHEMBL4281048)
Affinity DataIC50:  1nMAssay Description:Inhibition of recombinant full length His-tagged human CDK9/CyclinT1 expressed in baculovirus expression systemMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50454411(CHEMBL4209151)
Affinity DataIC50:  1nMAssay Description:Inhibition of N-terminal GST-HIS6 fusion protein tagged human full length CDK9 (M1 to F372 residues)/N-terminal GST-HIS6 fusion protein tagged human ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50553494(CHEMBL4764625)
Affinity DataIC50:  1nMAssay Description:Inhibition of His-tagged human CDK9/cyclin T1 expressed in insect cells using biotin Ttds-YISPLKSPYKISEG as substrate preincubated for 15 mins follow...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM642552(US20230416221, Compound 28)
Affinity DataIC50:  1nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605558(US11673893, Example 30)
Affinity DataIC50:  1.01nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605527((1S,3R)-N-(5-chloro-4-(7-fluoro-3-isopropyl-2-meth...)
Affinity DataIC50:  1.04nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM642548(US20230416221, Compound 20)
Affinity DataIC50:  1.04nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605563(US11673893, Example 35)
Affinity DataIC50:  1.04nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605611(US11673893, Example 80)
Affinity DataIC50:  1.09nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50598065(CHEMBL5208459)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) preincubated for 10 mins followed by ATP and CTD3 addition and measured after 30 mins by mobility shift...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50564818(CHEMBL4779614)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM50573963(CHEMBL4876233)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605559(US11673893, Example 31)
Affinity DataIC50:  1.29nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605564(US11673893, Example 36)
Affinity DataIC50:  1.37nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University

Curated by ChEMBL
LigandPNGBDBM605605(US11673893, Example 75)
Affinity DataIC50:  1.38nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
Displayed 1 to 50 (of 3311 total ) | Next | Last >>
Jump to: