TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.400nMAssay Description:Inhibition of N-terminal GST-HIS6 fusion protein tagged human full length CDK9 (M1 to F372 residues)/N-terminal GST-HIS6 fusion protein tagged human ...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.406nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.416nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.455nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.477nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.480nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.489nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.498nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: <0.5nMAssay Description:Displacement of Alexa Fluor 647 ADP Tracer from His-tagged human CDK9/Cyclin T1 expressed in baculovirus expression system incubated for 1 hr by adap...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.520nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.528nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.539nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: >0.600nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.694nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.699nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.700nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.743nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.760nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.780nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.794nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.820nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.837nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.890nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.900nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.938nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.961nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.979nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.980nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 0.984nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Selected compounds disclosed herein were tested in kinase assays by Nanosyn (Santa Clara, Calif.) to determine their inhibitory effect on these CDKs....More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMpH: 8.0Assay Description:Recombinant full-length His-tagged human CDK9 and CycT1, expressed in insect cells and purified by Ni-NTA affinity chromatography, were purchase from...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK9/cyclin T1 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human recombinant full length His-tagged CDK9/cyclin T1 expressed in insect cells using biotin-Ttds-YISPLKSPYKISEG as substrate preincu...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK9/cyclin T1 (unknown origin) using cdk7tide peptide as substrateMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of N-terminal GST-HIS6 fusion protein tagged human full length CDK9 (M1 to F372 residues)/N-terminal GST-HIS6 fusion protein tagged human ...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant full length His-tagged human CDK9/CyclinT1 expressed in baculovirus expression systemMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of N-terminal GST-HIS6 fusion protein tagged human full length CDK9 (M1 to F372 residues)/N-terminal GST-HIS6 fusion protein tagged human ...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of His-tagged human CDK9/cyclin T1 expressed in insect cells using biotin Ttds-YISPLKSPYKISEG as substrate preincubated for 15 mins follow...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.01nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.04nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.04nMAssay Description:The DMSO diluted compounds and the control compounds Dinaciclib, JSH-009, BAY-1211152, AZD4573 (all purchased from MCE, China) were mixed with the de...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.04nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.09nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.10nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) preincubated for 10 mins followed by ATP and CTD3 addition and measured after 30 mins by mobility shift...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.20nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.20nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.29nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.37nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Semmelweis University
Curated by ChEMBL
Semmelweis University
Curated by ChEMBL
Affinity DataIC50: 1.38nMAssay Description:The inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (Greiner Bio-One). CDK4/Cyc...More data for this Ligand-Target Pair