Compile Data Set for Download or QSAR
maximum 50k data

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB (change energy unit to kcal/mol)

Found 2463 hits in this display   

TargetCyclin-A2/Cyclin-dependent kinase 1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  1nM ΔG°:  -50.9kJ/molepH: 7.4 T: 2°CAssay Description:In vitro CDK enzymatic assay using purified CDK mixed with cyclin A, was incubated with substrate, and test compounds in the presence of 1.4 uM ATP/ ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataKi:  1.70nMAssay Description:Inhibition of human N-terminal His-tagged non-phosphorylated VEGFR2 after 10 mins by Global fit analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  2.20nM ΔG°:  -49.4kJ/molepH: 8.0 T: 2°CAssay Description:Assays were performed for the Itk enzyme containing residues 357-620, and an Itk enzyme containing the catalytic kinase domain and the TH and SH2 dom...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK4(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  2.60nMAssay Description:Kinase was assayed in 384-well polypropylene plate format. The compound was mixed with kinase and biotinylated peptide substrate and incubated. After...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  2.90nM ΔG°:  -48.2kJ/molepH: 7.4 T: 2°CAssay Description:In vitro CDK enzymatic assay using purified CDK mixed with cyclin A, was incubated with substrate, and test compounds in the presence of 1.4 uM ATP/ ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Oxford

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  4nMAssay Description:Inhibition of CDK2/Cyclin A (174 to 432 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Oxford

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  7nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  7.80nM ΔG°:  -48.1kJ/molepH: 7.4 T: 2°CAssay Description:In vitro Chk1 enzymatic assay using purified enzyme, was incubated with substrate, and test compounds in the presence of 10 uM ATP/ [gamma-32P] ATP. ...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi: <10nM ΔG°: <-45.7kJ/molepH: 8.0 T: 2°CAssay Description:Assays were performed for the Itk enzyme containing residues 357-620, and an Itk enzyme containing the catalytic kinase domain and the TH and SH2 dom...More data for this Ligand-Target Pair
TargetProtein kinase C beta type(Rattus norvegicus (rat))
University of California San Diego

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  19nM ΔG°:  -44.8kJ/moleT: 2°CAssay Description:Protein kinase C (PKC) enzyme inhibition assay using purified rat brain protein kinase C from Calbiochem #539494.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataKi:  22nMAssay Description:Inhibition of GSK3-beta assessed as NADH level after 10 mins by pyruvate kinase/lactate dehydrogenase coupled spectrophotometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase(Oryctolagus cuniculus (Rabbit))
University of California San Diego

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  35nMpH: 7.5Assay Description:Cyclic AMP-dependent protein kinase (PKA) enzyme inhibition assay using purified recombinant C subunit of PKA (catalytic (C) subunit (cPKA)) with hol...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  41nM ΔG°:  -42.9kJ/molepH: 7.5 T: 2°CAssay Description:CDK4 and cyclin D1 were expressed in a baculovirus expression system and subsequently purified. The catalytic activity of the CDK4 protein was assaye...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  150nMAssay Description:Kinase was assayed in 384-well polypropylene plate format. The compound was mixed with kinase and biotinylated peptide substrate and incubated. After...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  790nM ΔG°:  -34.5kJ/molepH: 7.5 T: 2°CAssay Description:Kinase was assayed in 384-well polypropylene plate format. The compound was mixed with kinase and biotinylated peptide substrate and incubated. After...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  1.20E+3nMAssay Description:Kinase was assayed in 384-well polypropylene plate format. The compound was mixed with kinase and biotinylated peptide substrate and incubated. After...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LMTK3(Homo sapiens)
San Diego State University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.00200nMAssay Description:Inhibition of LMTK3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0310nMAssay Description:Inhibition of human CAMK2A using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit delta(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0310nMAssay Description:Inhibition of human CAMK2D using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0470nMAssay Description:Inhibition of human STK22D using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0520nMAssay Description:Inhibition of human STK22D using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0640nMAssay Description:Inhibition of human TRKB using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0640nMAssay Description:Inhibition of human CAMK2B using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0640nMAssay Description:Inhibition of human CAMK2A using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit delta(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0650nMAssay Description:Inhibition of human CAMK2D using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Kyung Hee University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  0.0700nMAssay Description:Inhibition of ROS1 by HotSpot assay relative to controlMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0700nMAssay Description:Inhibition of CAMK2b (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0800nMAssay Description:Inhibition of human RSK2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0830nMAssay Description:Inhibition of human GLK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0830nMAssay Description:Inhibition of human GLK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0890nMAssay Description:Inhibition of human PIM3 using RSRHSSYPAGT as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0900nMAssay Description:Inhibition of RSK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0910nMAssay Description:Inhibition of human JAK3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0930nMAssay Description:Inhibition of human TRKB using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0950nMAssay Description:Inhibition of human CAMK2B using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.0980nMAssay Description:Inhibition of human PIM3 using RSRHSSYPAGT as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.100nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.100nMAssay Description:Inhibition of JAK3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.100nMAssay Description:Inhibition of PHKgamma2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.100nMAssay Description:Inhibition of SYKMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.100nMAssay Description:Inhibition of CAMK2BMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.100nMAssay Description:Inhibition of CHK1More data for this Ligand-Target Pair
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.100nMAssay Description:Inhibition of RSK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.100nMAssay Description:Inhibition of PDGFRalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.114nMAssay Description:Inhibition of human MARK4 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.115nMAssay Description:Inhibition of human JAK2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.120nMAssay Description:Inhibition of JAK3 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.121nMAssay Description:Inhibition of human PIM3 using RSRHSSYPAGT as substrate in presence of [gamma-33P]-ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNT-3 growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.123nMAssay Description:Inhibition of human TRKC using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.124nMAssay Description:Inhibition of human RSK2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.126nMAssay Description:Inhibition of human RSK1 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.126nMAssay Description:Inhibition of human RSK1 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.128nMAssay Description:Inhibition of human PKCdelta using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.129nMAssay Description:Inhibition of human PKCdelta using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.131nMAssay Description:Inhibition of human MARK4 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.133nMAssay Description:Inhibition of human MARK2 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.133nMAssay Description:Inhibition of human SYK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetRibosomal protein S6 kinase alpha-6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.134nMAssay Description:Inhibition of human RSK4 using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.138nMAssay Description:Inhibition of human JAK3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.140nMAssay Description:Inhibition of human RSK3 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.142nMAssay Description:Inhibition of human CHK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.143nMAssay Description:Inhibition of human PKCepsilon using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Kyung Hee University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.145nMAssay Description:Inhibition of human ROS using KKKSPGEYVNIEFG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.148nMAssay Description:Inhibition of human MARK2 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Kyung Hee University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.149nMAssay Description:Inhibition of human ROS using KKKSPGEYVNIEFG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.150nMAssay Description:Inhibition of JAK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.159nMAssay Description:Inhibition of human RSK4 using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.160nMAssay Description:Inhibition of CHK1 (unknown origin)More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.177nMAssay Description:Inhibition of human KHS using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  0.180nMAssay Description:Inhibition of FLT3 by colorimetric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.184nMAssay Description:Inhibition of human JAK3 using GEEEEYFELVKKKK as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.186nMAssay Description:Inhibition of human CHK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.189nMAssay Description:Inhibition of human JAK2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK gamma(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.190nMAssay Description:Inhibition of human DMPK2 using KKRPQRRYSNVF as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.198nMAssay Description:Inhibition of human PKCepsilon using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit epsilon(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.199nMAssay Description:Inhibition of human IKKepsilon using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.200nMAssay Description:Inhibition of FLT3 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Kyung Hee University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.200nMAssay Description:Inhibition of ROS (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.200nMAssay Description:Inhibition of human N-terminal GST-tagged FLT3 (564 to 993 residues) expressed in baculovirus expression system using peptide FAM-P2 as substrate inc...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.203nMAssay Description:Inhibition of human FER using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.205nMAssay Description:Inhibition of human TYK2 using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1D(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.206nMAssay Description:Inhibition of human CAMK1D using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.212nMAssay Description:Inhibition of human PAK1 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.217nMAssay Description:Inhibition of human SYK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetNT-3 growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.220nMAssay Description:Inhibition of human TRKC using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.227nMAssay Description:Inhibition of human RSK3 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.234nMAssay Description:Inhibition of human TYK2 using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMisshapen-like kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.235nMAssay Description:Inhibition of human MINK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.235nMAssay Description:Inhibition of human PAK3 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.246nMAssay Description:Inhibition of human ROCK2 using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C eta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.251nMAssay Description:Inhibition of human PKCeta using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.254nMAssay Description:Inhibition of recombinant His-tagged human FLT3 D835Y mutant (564 to 958 residues) expressed in baculovirus expression system by LanthaScreen assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.259nMAssay Description:Inhibition of recombinant N-terminal GST/His6-tagged human FLT3 ITD mutant (571 to 993 residues) expressed in insect cells by LanthaScreen assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetSerine/threonine-protein kinase MARK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.261nMAssay Description:Inhibition of human MARK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.297nMAssay Description:Inhibition of human MARK3 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1D(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.298nMAssay Description:Inhibition of human CAMK1D using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.300nMAssay Description:Inhibition of PAK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.305nMAssay Description:Inhibition of human PKCalpha using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.309nMAssay Description:Inhibition of human KHS using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.310nMAssay Description:Inhibition of JAK2 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.314nMAssay Description:Inhibition of human TNIK using RLGRDKYKTLRQIRQ as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 1(Mus musculus)
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.330nMAssay Description:Inhibition of mouse TSSK1 by luminescent ADP-Glo assay kitMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.336nMAssay Description:Inhibition of human PHKgamma2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.343nMAssay Description:Inhibition of human PAK3 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.345nMAssay Description:Inhibition of human SIK2 using AMARAASAAALARRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.348nMAssay Description:Inhibition of human HGK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.351nMAssay Description:Inhibition of human TYK2 using KKSRGDYMTMQIG as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.360nMAssay Description:Inhibition of CDK2/cyclinAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.365nMAssay Description:Inhibition of human FER using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDiscoidin domain-containing receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.367nMAssay Description:Inhibition of human DDR2 using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.370nMAssay Description:Inhibition of human SIK2 using AMARAASAAALARRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.370nMAssay Description:Inhibition of PKCalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.387nMAssay Description:Inhibition of human CAMK2G using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.400nMAssay Description:Inhibition of JAK2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 3(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.410nMAssay Description:Inhibition of MST2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.417nMAssay Description:Inhibition of human MARK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.418nMAssay Description:Inhibition of human PDGFRalpha using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.426nMAssay Description:Inhibition of human MSK1 using GRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.430nMAssay Description:Inhibition of PDGFRalpha (unknown origin) by HTRF methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.430nMAssay Description:Inhibition of human p70S6K using KKRNRTLTK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.438nMAssay Description:Inhibition of human MARK3 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit epsilon(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.439nMAssay Description:Inhibition of human IKKepsilon using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.444nMAssay Description:Inhibition of human ROCK1 using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.450nMAssay Description:Inhibition of PDGFRalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.450nMAssay Description:Inhibition of SYK (unknown origin)More data for this Ligand-Target Pair
TargetMisshapen-like kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.451nMAssay Description:Inhibition of human MINK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.458nMAssay Description:Inhibition of human SIK1 using AMARAASAAALARRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.460nMAssay Description:Inhibition of RETMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.460nMAssay Description:Inhibition of Aurora A (unknown origin) using kemptide as substrate incubated for 50 mins in the presence of ATP by ADP-Glo reagent based luminescenc...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetSerine/threonine-protein kinase TAO1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.469nMAssay Description:Inhibition of human TAOK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetMisshapen-like kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.470nMAssay Description:Inhibition of MINK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.473nMAssay Description:Inhibition of LYN (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.474nMAssay Description:Inhibition of human PKCalpha using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.474nMAssay Description:Inhibition of human PKCalpha using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHexokinase-4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.488nMAssay Description:Inhibition of human GCK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.490nMAssay Description:Inhibition of PHKg2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.490nMAssay Description:Inhibition of LYNMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMisshapen-like kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.490nMAssay Description:Inhibition of MINKMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.498nMAssay Description:Inhibition of human BRSK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.5nMAssay Description:Inhibition of RSK2 using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.5nMAssay Description:Inhibition of RSK1 using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.5nMAssay Description:Inhibition of CHK1 using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate ...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <0.5nMAssay Description:Inhibition of CHK1More data for this Ligand-Target Pair
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.5nMAssay Description:Inhibition of TRKA (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.5nMAssay Description:Inhibition of JAK3 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.5nMAssay Description:Inhibition of DAPK1More data for this Ligand-Target Pair
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.506nMAssay Description:Inhibition of human PKCalpha using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.506nMAssay Description:Inhibition of human PDK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.520nMAssay Description:Inhibition of FLT3 (unknown origin) by HTRF methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.538nMAssay Description:Inhibition of human PDK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.541nMAssay Description:Inhibition of human PAK1 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.542nMAssay Description:Inhibition of human PKCa using histone H1 as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMaternal embryonic leucine zipper kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.542nMAssay Description:Inhibition of human MELK using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.542nMAssay Description:Inhibition of human PKCgamma using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.544nMAssay Description:Inhibition of human MLK1 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.551nMAssay Description:Inhibition of human TNIK using RLGRDKYKTLRQIRQ as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.553nMAssay Description:Inhibition of human p70S6K using KKRNRTLTK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.570nMAssay Description:Inhibition of human HGK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.580nMAssay Description:Inhibition of PDGFRA (unknown origin) using FAM-labeled peptide as substrate preincubated for 10 mins followed by substrate addition measured after 6...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TNK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.584nMAssay Description:Inhibition of human TNK1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of Aurora A using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence micropl...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of PDGFRbeta (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of EGFR T790M mutant (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of TYK2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of PDGFRalpha (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of N-terminal His-tagged recombinant PKC-epsilon (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of human CDK2/cyclin-A using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.603nMAssay Description:Inhibition of human PKAcb using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.620nMAssay Description:Inhibition of human PHKgamma2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.627nMAssay Description:Inhibition of human JAK1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.628nMAssay Description:Inhibition of human STK38 using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.631nMAssay Description:Inhibition of human JAK1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.640nMAssay Description:Inhibition of ROCK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.640nMAssay Description:Inhibition of AKT3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.656nMAssay Description:Inhibition of human CAMK2G using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fgr(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.658nMAssay Description:Inhibition of human FGR using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.680nMAssay Description:Inhibition of ROCK1 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMaternal embryonic leucine zipper kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.687nMAssay Description:Inhibition of human MELK using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.690nMAssay Description:Inhibition of ASK1 (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.700nMAssay Description:Inhibition of PKCalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.700nMAssay Description:Inhibition of human FLT4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.700nMAssay Description:Inhibition of PKA (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.710nMAssay Description:Inhibition of human FLT3 D835Y mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.720nMAssay Description:Inhibition of CDK2/cyclin A (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.726nMAssay Description:Inhibition of human p70S6Kb using KKRNRTLTK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.727nMAssay Description:Inhibition of human CDK2/cyclin-A using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.727nMAssay Description:Inhibition of human MRCKbeta using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.728nMAssay Description:Inhibition of human LYN using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.755nMAssay Description:Inhibition of human FLT3 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.757nMAssay Description:Inhibition of human FGFR2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.760nMAssay Description:Inhibition of recombinant human PDGFRbeta expressed in insect cells using Ulight-Poly GAT[EAY(1:1:1)]n as substrate after 30 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.793nMAssay Description:Inhibition of human PDGFRalpha using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.799nMAssay Description:Inhibition of human ROCK1 using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.800nMAssay Description:The reaction procedure was conducted as follows:1) Prepare substrate in freshly prepared Reaction Buffer.2) MnCl2 (2 mM) was added as a co-factor lis...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.805nMAssay Description:Inhibition of human LYN using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHexokinase-4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.810nMAssay Description:Inhibition of human GCK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.820nMAssay Description:Inhibition of recombinant human N-terminal GST-HIS6 fused RET V804L mutant C-terminal domain (H658 to S1114 residues) expressed in Sf9 insect cells u...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.830nMAssay Description:Inhibition of c-Src using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.830nMAssay Description:Inhibition of human FLT3 R595_E596 mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.831nMAssay Description:Inhibition of human STK38L using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK gamma(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.848nMAssay Description:Inhibition of human DMPK2 using KKRPQRRYSNVF as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.856nMAssay Description:Inhibition of human BRSK1 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.860nMAssay Description:Inhibition of Aurora A (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLysine--tRNA ligase(Homo sapiens (Human))
Yunnan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.860nMAssay Description:Inhibition of SYK (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.871nMAssay Description:Inhibition of human S6K1 using KKRNRTLTK peptide substrate by radiometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.900nMAssay Description:Inhibition of PKAMore data for this Ligand-Target Pair
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.900nMAssay Description:Inhibition of N-terminal His-tagged recombinant IKK2 (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.900nMAssay Description:Inhibition of FLT4 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.933nMAssay Description:Inhibition of human ROCK2 using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.935nMAssay Description:Inhibition of human PKA using LCGRTGRRNSI as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.936nMAssay Description:Inhibition of human Aurora A using [H-LRRASLG] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.964nMAssay Description:Inhibition of human LYN-B using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1B(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.967nMAssay Description:Inhibition of human DYRK1B using RRRFRPASPLRGPPK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK3(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.972nMAssay Description:Inhibition of human SIK3 using AMARAASAAALARRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  0.998nMAssay Description:Inhibition of human MRCKalpha using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 4(Homo sapiens (Human))
Inner Mongolia Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of protein kinase C epsilon expressed in Sf-9 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human MST1 using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of Aurora A(unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of FLT3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of Lyn (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of SYK (unknown origin)More data for this Ligand-Target Pair
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of GST-tagged human CDK2/Cyclin A2 expressed in baculovirus infected Sf9 cells using 5-FAM-QSPKKG-CONH2 as substrate incubated for 60 mins...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of ALK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human PKCepsilonMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of LCK (unknown origin) after 120 mins in presence of 33P-ATPMore data for this Ligand-Target Pair
TargetLeucine-rich repeat serine/threonine-protein kinase 2(Homo sapiens (Human))
The University Of Sydney

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human N-terminal GST-tagged LRRK2 after 1 hr by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human recombinant JAK3 using Ulight-CAGAGAIETDKEYYTVKD as substrate by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Shown are the IC50s (concentrations causing 50% inhibition) of DM and the analogues for the in vitro kinase assays using the following purified human...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:1H-pyrrolo[2,3-b]pyridine series of compounds and analogues in Table 3B were synthesized and tested in 10-dose IC50 mode with 3 fold serial dilutions...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:1H-pyrrolo[2,3-b]pyridine series of compounds and analogues in Table 3B were synthesized and tested in 10-dose IC50 mode with 3 fold serial dilutions...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:1H-pyrrolo[2,3-b]pyridine series of compounds and analogues in Table 3B were synthesized and tested in 10-dose IC50 mode with 3 fold serial dilutions...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of Src protein tryrosine kinaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 2(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of PAK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of FLT3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of Aurora B (unknown origin) using [33P]-ATP and 10 uM ATP after 2 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of src kinaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1nMAssay Description:Inhibition of CamK2alphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of PKCaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1nMAssay Description:Inhibition of KitMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of JAK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Kyung Hee University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of ROSMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of TRKBMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of SYKMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of FLT3 (unknown origin) using EAIYAAPFAKKK substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of ALK (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of Aurora A (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1/G1/S-specific cyclin-E2(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of CDK2/cyclin E (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of FLT3 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of Jak3 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of Lyn (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of PKA (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Kyung Hee University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of ROS1 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of SYK (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of Extracellular signal-regulated kinase 2 (Erk2)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 6(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of Mitogen activated protein kinase kinase 6More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 4(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of Mitogen activated protein kinase kinase 4More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1nMAssay Description:Inhibition of human Aurora A using H-LRRASLG as substrate after 2 hrs by HotSpot assay in presence of 33P-ATP and 1 uM ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human Aurora B using H-LRRASLG as substrate after 2 hrs by HotSpot assay in presence of 33P-ATP and 1 uM ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human recombinant JAK3 assessed as reduction in Ulight-CAGAGAIETDKEYYTVKD phosphorylation pre-incubated before substrate addition and m...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of P70S6K (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of FLT3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of IKKbeta (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N1(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1nMAssay Description:Inhibition of PRK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.01nMAssay Description:1H-pyrrolo[2,3-b]pyridine, 1H-pyrazolo[3,4-b]pyridine and 5H-pyrrolo[2,3-b]pyrazine series of compounds exhibited over >100 fold selective against Ja...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.08nMAssay Description:Inhibition of human SYK using poly[Glu:Tyr] (4:1) as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase Blk(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of human BLK using poly[Glu:Tyr](4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of human FYN using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase Blk(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of human BLK using poly[Glu:Tyr](4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of human ALK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of N-terminal GST-fused human recombinant full length ZAP70 (1 to 619 residues) expressed in baculovirus-infected Sf21 cells using FAM-22 ...More data for this Ligand-Target Pair
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1B(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of human DYRK1B using RRRFRPASPLRGPPK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of human PKG1alpha using LRRASLG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of ROCK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of EGFR T790M/L858R mutant (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of FMS (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of FMS (unknown origin) in presence of ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human ULK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDiscoidin domain-containing receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human DDR2 using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C eta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human PKCeta using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 2(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human PAK2 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of N-terminal GST tagged recombinant full-length human CHK1 expressed in baculovirus Sf9 insect cells after 10 mins by luminescent ADP-Glo...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase N1(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of PKN1 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of FLT3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of CDK5/P25 (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured afte...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human PKAcb using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of recombinant human C-terminal His-tagged/N-terminal GST-tagged EGFR (668 to 1210 residues) T790M/L858R/C797S mutant using poly (Glu,Tyr)...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase Fgr(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human FGR using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human PKG1alpha using LRRASLG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK3(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human SIK3 using AMARAASAAALARRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human TAOK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetRho-associated protein kinase 2(Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:The kinase activity was determined by incubation of enzyme and its substrate, and test compound, in the presence ATP/[gamma-33P] ATP. After incubatio...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of RSK1 (unknown origin) by Z-LYTE kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of PKCalpha (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human N-terminal His-tagged non-phosphorylated VEGFR2 preincubated for 120 mins in presence of ATP by AlphaScreen analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human FMS using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human PKAcg using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of recombinant human N-terminal GST-HIS6 fused RET M918T mutant C-terminal domain (H658 to S1114 residues) expressed in Sf9 insect cells u...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of recombinant human N-terminal GST-HIS6 fused RET V804M mutant C-terminal domain (H658 to S1114 residues) expressed in Sf9 insect cells u...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of N-terminal GST-fused human recombinant full length SYK (1 to 635 residues) expressed in baculovirus-infected Sf21 cells using FAM-22 pe...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human CDK5/p35 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of SYK (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase D2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human PKD2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of TRKA (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of ZAP70 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase SIK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human SIK1 using AMARAASAAALARRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human TAOK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 1(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human ARK5 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 1(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human ARK5 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of cSRCMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of LCK using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate a...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of LYNMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of CDK1/Cyclin BMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.30nMAssay Description:Inhibition of human LynMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.39nMAssay Description:Inhibition of human LYN using poly[Glu:Tyr] (4:1) as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Minnesota

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human CDK2/cyclin-E using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human CDK1/cyclinB using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 6(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human MKK6 using p38alpha as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 1(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human ARK5 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of recombinant wild-type human N-terminal GST-HIS6 fused RET C-terminal domain (H658 to S1114 residues) expressed in Sf9 insect cells usin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human Aurora A using [H-LRRASLG] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of LCK (unknown origin)More data for this Ligand-Target Pair
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of TNIK (unknown origin) by ADP glo luminescent assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human MSK1 using GRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human TRKA using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human CDK1/cyclinB using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 1(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human ARK5 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit PRKX(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human PRKX using LRRASLG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human PKCb2 using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human PKCb2 using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human PKCgamma using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C theta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human PKCtheta using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase D1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human PKCmu using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of CDK2/Cyclin AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of MSK1 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-O(Homo sapiens)
University Of Minnesota

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of CDK2/Cyclin-O (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor TYRO3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human TYRO3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Minnesota

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human CDK2/cyclin-A1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKinesin-1 heavy chain/Proto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
Xiamen University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of KIF5B-RET fusion protein (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-O(Homo sapiens)
University Of Minnesota

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human CDK2/cyclin-O using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of Aurora B (unknown origin) using myelin protein as substrate assessed as ADP generation after 60 mins by ADP-glo assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fes/Fps(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human FES using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human FLT3 by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human STK38L using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-O(Homo sapiens)
University Of Minnesota

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human CDK2/cyclin-O using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human PKCnu using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human MLK1 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit PRKX(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human PRKX using LRRASLG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human PKD2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-O(Homo sapiens)
University Of Minnesota

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of human CDK2/cyclin-O using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.5nMpH: 7.5 T: 2°CAssay Description:The kinase assay uses His-Akt1 and a biotinylated peptide as substrate. The biotinylated peptides were immobilized on streptavidin-coated FLASH plat...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of recombinant PKCE expressed in Bac-to Bac baculovirus systemMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.5nMAssay Description:Inhibition of LckMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.58nMAssay Description:Inhibition of human PKACA using LCGRTGRRNSI as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of CDK2/Cyclin E (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of human TRKA using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of human LCK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of CDK1/cyclin B (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of human MST1 using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of CDK1/cyclinBMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of human CDK2/cyclin-E using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of human CDK3/cyclin-E using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of human KDR by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of human FLT3 F594_R595insR mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of RET (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of CDK1/Cyclin A (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of human SNARK using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-O(Homo sapiens)
University Of Minnesota

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of human CDK2/cyclin-O using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of Trk-AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of CDK2/cyclin A2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.70nMAssay Description:Inhibition of human wild type ALK using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition afte...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of human ZIPK using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Minnesota

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of human CDK2/cyclin-A1 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TNK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of human TNK1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of FGFR2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of human FLT3 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of FER (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of Aurora B (unknown origin) using HLRRASLG substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of FGFR2 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.80nMAssay Description:Inhibition of LCK (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 19(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human YSK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human CDK5/p35 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human CDK1/Cyclin-A using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human PHKgamma1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human Aurora C using [H-LRRASLG] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 4(Homo sapiens (Human))
Inner Mongolia Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of recombinant human N-terminal GST-fused PAK4 (1 to 591 residues) expressed in baculovirus expression system using S2 as substrate measur...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase HCK(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human HCK using KVEKIGEGTYGVVYK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human SNARK using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 25(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human STK25 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 25(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human STK25 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of FLT4More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of CDK2/Cyclin EMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N2(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human PKN2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human RET using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInactive tyrosine-protein kinase PEAK1(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human PEAK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of Platelet-derived growth factor receptor in P19 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human Aurora A using H-LRRASLG as substrate after 2 hrs by HotSpot assay in presence of 33P-ATP and 10 uM ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human recombinant JAK2 expressed in Sf21 cells assessed as reduction in Ulight-CAGAGAIETDKEYYTVKD phosphorylation pre-incubated before ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of FynMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of JAK2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibitory activity against Cyclin D1-cyclin-dependent kinase 4 by measuring the phosphorylation of RbINGMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha/beta(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research & Development

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of Protein kinase C beta 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human FLT3 F594_R595insREY mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human FLT3 ITD-W51 mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human recombinant JAK2 using Ulight-CAGAGAIETDKEYYTVKD as substrate by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human FMS using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N2(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2nMAssay Description:Inhibition of human PKN2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human PKCnu using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human CDK3/cyclin-E using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human CDK3/cyclin-E using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fes/Fps(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human FES using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:The reaction procedure was conducted as follows:1) Prepare substrate in freshly prepared Reaction Buffer.2) MnCl2 (2 mM) was added as a co-factor lis...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetEpithelial discoidin domain-containing receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human DDR1 using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human CDK5/p25 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of LYNA (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Competitive inhibition of human CHK1 using ATP as substrate by DELFIAMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase TAO3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human TAOK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of recombinant human KDR expressed in Sf9 insect cells using Ulight-CAGAGAIETDKEYYTVKD as substrate after 60 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human FGFR2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human FYN using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of human CDK1/cyclinB using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G1/S-specific cyclin- 1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of CDK1/cyclin E (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of human CDK1/cyclinB using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCoiled-coil domain-containing protein 6(Homo sapiens (Human))
Xiamen University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of human N-terminal GST-HIS6 fused CCDC6-RET fusion protein (Met1 to Ser503 residues) expressed in Sf9 insect cells using TRK-C-derived pe...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of c-SRC (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TBK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of human TBK1 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N2(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of PKN2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.30nMAssay Description:Inhibition of human PDGFRbeta using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.30nMAssay Description:Inhibition of VEGFR3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.30nMAssay Description:Inhibition of human BRSK2 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.30nMAssay Description:Inhibition of Aurora-AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.30nMAssay Description:Inhibition of EGFR L858R/T790M mutant (unknown origin) in presence of radiolabelled gammaATP by radioisotope filter binding assayMore data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.30nMAssay Description:The inhibitory activities of compounds of Formula I were assay at Reaction Biology Corporation, One Great Valley Parkway, Malvern, Pa., USA. Human ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.30nMAssay Description:Inhibition of N-terminal His-tagged recombinant JAK2 (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.30nMAssay Description:Inhibition of PKACalpha (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
The Ohio State University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.35nMAssay Description:Inhibition of human YES/YES1 using poly[Glu:Tyr] (4:1) as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of ALK using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of C-terminal His6 tagged human full length CDK1/N-terminal GST-tagged human full length Cyclin B expressed in baculovirus infected Sf21 c...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of human FGFR1 using KKKSPGEYVNIEFG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
The Ohio State University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of human YES using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetLIM domain kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of human LIMK1 using cofilin as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of human Aurora C using [H-LRRASLG] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of human p70S6Kb using KKRNRTLTK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of human GSK3A using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of PKCalpha (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.40nMAssay Description:Inhibition of Aurora A (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  2.5nMAssay Description:Inhibition of Mitogen-activated protein kinase (MAPK)phosphorylation by activated MEK-1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.5nMAssay Description:Inhibition of CDK1/cyclin B (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.5nMAssay Description:Inhibition of human PKCb2 using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.5nMAssay Description:Inhibition of human MEK3 using p38alpha as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.5nMAssay Description:Inhibition of human PAK5 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  2.5nMAssay Description:Inhibition of MEK1 phosphorylation by activated human recombinant RafMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of SRC (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C theta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of human PKCtheta using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of GSK3b (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetPhosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of human PHKgamma1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of human c-SRC using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 2(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of PAK2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
The Ohio State University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of human YES using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of CDK2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.68nMAssay Description:Inhibition of human LCK using poly[Glu:Tyr] (4:1) as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase 25(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human STK25 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of PIM1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human ULK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 10(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human MLK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha/beta/gamma type(Rattus norvegicus (Rat))
Nova Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:In vitro inhibition of [32P] incorporation into histones by rat brain partially purified Protein kinase C in the presence of PMA, [Ca2+] and phosphat...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human LIMK1 using cofilin as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of PIM1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human LCK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human CDK5/p25 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human FLT4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human LYN-B using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.76nMAssay Description:Inhibition of human PKCg using histone H1 as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor TYRO3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.80nMAssay Description:Inhibition of human TYRO3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.80nMAssay Description:Inhibition of human PKCb2 using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.80nMAssay Description:Inhibition of human PKG1beta using LRRASLG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 10(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.80nMAssay Description:Inhibition of human MLK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 3(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.80nMAssay Description:Inhibition of human MST2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 26(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.90nMAssay Description:Inhibition of human MST4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  2.90nMAssay Description:Inhibition of CDK6/Cyclin D1 (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measure...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.90nMAssay Description:Inhibition of human CLK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.90nMAssay Description:Inhibition of human c-SRC using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.90nMAssay Description:Inhibition of human CDK3/cyclin-E using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCytoplasmic tyrosine-protein kinase BMX(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human BMX using poly[Glu:Tyr](4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase HCK(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human HCK using KVEKIGEGTYGVVYK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human Aurora A using [H-LRRASLG] as substrate in presence of [gamma-33P]-ATP incubated for 2 hrs by hotspot kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human recombinant JAK1 using Ulight-CAGAGAIETDKEYYTVKD as substrate by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human ALK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Rattus norvegicus)
Cephalon

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of protein kinase CMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human MSK2 using GRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1B(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of DYRK1B (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of AlkMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human recombinant JAK1 assessed as reduction in Ulight-CAGAGAIETDKEYYTVKD phosphorylation pre-incubated before substrate addition and m...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human PKCalpha activity using kemptide as a substrate in presence of 50 uM ATP by mass spectrometryMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of recombinant Syk (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of AXL (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInactive tyrosine-protein kinase PEAK1(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human PEAK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human Syk expressed in Sf9 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human CAMK1A using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1A(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.10nMAssay Description:Inhibition of human DYRK1A using RRRFRPASPLRGPPK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.10nMAssay Description:Inhibition of c-Src (unknown origin) in presence of ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.10nMAssay Description:Inhibition of FMSMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.20nMAssay Description:Inhibition of CDK1/cyclin BMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.20nMAssay Description:Inhibition of human TSSK3 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.29nMAssay Description:Shown are the IC50s (concentrations causing 50% inhibition) of DM and the analogues for the in vitro kinase assays using the following purified human...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of CHK2 using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 9(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of CDK9/cyclin T1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of CDK1/Cyclin BMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human FLT4 by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human PKG1beta using LRRASLG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 24(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human MST3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 24(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human MST3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human ZAP70 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human CAMK1A using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human BRSK2 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human TSSK2 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  3.40nMAssay Description:Inhibition of human N-terminal His-tagged non-phosphorylated VEGFR2 in presence of ATP measured without preincubation by AlphaScreen analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.40nMAssay Description:Inhibition of human TLK2 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.40nMAssay Description:Inhibition of FLT3 (unknown origin) in presence of ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.40nMAssay Description:Inhibition of FGFR2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.40nMAssay Description:Inhibition of human RET using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.5nMAssay Description:Inhibition of human ZIPK using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.5nMAssay Description:Inhibition of human KDR using and Ulight-CAGAGAIETDKEYYTVKD as substrate after 1 hr by FRET assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.5nMAssay Description:Inhibition of human TAOK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PAK 2(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.5nMAssay Description:Inhibition of human PAK2 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.5nMAssay Description:Inhibition of KDRMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.60nMAssay Description:Inhibition of human ITK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetcAMP-dependent protein kinase catalytic subunit alpha(Bos taurus (bovine))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.60nMpH: 7.4 T: 2°CAssay Description:The kinase assay uses purified recombinant enzyme and a biotinylated peptide as substrate. The biotinylated peptides were immobilized on streptavidi...More data for this Ligand-Target Pair
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.60nMAssay Description:Inhibition of human PDGFRbeta using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.60nMAssay Description:Inhibition of human PKCmu using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.60nMAssay Description:Inhibition of recombinant human c-KIT using Ulight-TK peptide as substrate after 30 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeukocyte tyrosine kinase receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.60nMAssay Description:Inhibition of LTK (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.70nMAssay Description:Inhibition of Aurora A (unknown origin) using STK S2 as substrate after 40 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.70nMAssay Description:Inhibition of human ULK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.70nMAssay Description:Inhibition of human TLK2 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of human LATS2 using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N1(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of human PKN1 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of recombinant human Flt4 using Ulight-CAGAGAIETDKEYYTVKD as substrate after 90 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCDK9/Cyclin-T2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of human CDK9/cyclin-T2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of AKT1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of human N-terminal His-tagged phosphorylated VEGFR2 preincubated for 120 mins in presence of ATP by AlphaScreen analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMuscle, skeletal receptor tyrosine-protein kinase(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of MUSK (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition cSRCMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of CDK2/Cyclin E (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of CDK5/P35More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of human AKT3 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1B(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of human CAMK1B using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSNF-related serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of human SNRK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.90nMAssay Description:Inhibition of N-terminal His-tagged recombinant human AXL (473 to end amino acids) expressed by baculovirus in Sf9 cells using axltide substrate and ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.90nMAssay Description:Inhibition of human FGFR1 using KKKSPGEYVNIEFG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.90nMAssay Description:Inhibition of human KDR using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TBK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.90nMAssay Description:Inhibition of human TBK1 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of Protein kinase C alphaMore data for this Ligand-Target Pair
In DepthDetails Article
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of human GSK3A using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1G(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of human CAMK1G using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 25(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of human STK25 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 11(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of human MLK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of Protein kinase C beta 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of CDK3/Cyclin E (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of PKCbeta2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of Protein kinase C beta 2More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of CDK5/P25 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4nMAssay Description:Inhibition of LCKMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.02nMAssay Description:1H-pyrrolo[2,3-b]pyridine series of compounds and analogues in Table 3B were synthesized and tested in 10-dose IC50 mode with 3 fold serial dilutions...More data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.10nMAssay Description:Inhibition of KDR (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.10nMAssay Description:Inhibition of c-Kit (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N1(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.20nMAssay Description:Inhibition of human PKN1 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.20nMAssay Description:Inhibition of human ULK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.20nMAssay Description:Inhibition of human IRAK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.20nMAssay Description:Inhibition of His-tagged full length human recombinant GSK3beta using [YRRAAVPPSPSLSRHSSPHQ-(pS)EDEEE] substrate and pre-incubarted for 20 mins befor...More data for this Ligand-Target Pair
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.30nMAssay Description:Inhibition of human PDGFRbeta by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.30nMAssay Description:Inhibition of human PIM1 using KKRNRTLTK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpithelial discoidin domain-containing receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.30nMAssay Description:Inhibition of human DDR1 using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 24(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.30nMAssay Description:Inhibition of human MST3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.30nMAssay Description:Inhibition of human TSSK2 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
The Ohio State University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.40nMAssay Description:Inhibition of YES (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.40nMAssay Description:Inhibition of FYN (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetInterleukin-1 receptor-associated kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of human IRAK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of LCKMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of BRAF V599E mutant (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of KIT (unknown origin) by HTRF methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of BRAF V599E mutant(unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCyclin-dependent kinase/G1/S-specific cyclin- 1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of human CDK1/cyclinE using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.60nMAssay Description:Inhibition of human AKT1 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.60nMAssay Description:Inhibition of human PIM1 using KKRNRTLTK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.60nMAssay Description:Inhibition of RET (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.60nMAssay Description:Inhibition of AKT1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase FRK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.60nMAssay Description:Inhibition of human FRK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.60nMAssay Description:Inhibition of AKT1 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRhodopsin kinase GRK7(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.60nMAssay Description:Inhibition of human GRK7 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 3(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.70nMAssay Description:Inhibition of STK3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.70nMAssay Description:Inhibition of JAK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.70nMAssay Description:Inhibition of SRC (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.70nMAssay Description:Inhibition of human PIM2 using RSRHSSYPAGT as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Mer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.70nMAssay Description:Inhibition of human c-MER using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.70nMAssay Description:Inhibition of recombinant human PDGFRbeta using Ulight-Poly GAT[EAY(1:1:1)]n as substrate measured after 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.70nMAssay Description:Inhibition of RET (unknown origin) by HTRF methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.80nMAssay Description:Inhibition of human MRCKbeta using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.80nMAssay Description:Inhibition of VEGFR-2 (unknown origin) by HTRF methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Oxford

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.80nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.90nMAssay Description:Inhibition of CHK2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeucine-rich repeat serine/threonine-protein kinase 2(Homo sapiens (Human))
The University Of Sydney

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.90nMAssay Description:Inhibition of human LRRK2 using RLGRDKYKTLRQIRQ as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.90nMAssay Description:Inhibition of human CDK1 by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1A(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.90nMAssay Description:Inhibition of human DYRK1A using RRRFRPASPLRGPPK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C eta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of Protein kinase C etaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C eta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of Protein kinase C etaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of AKT3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of AKT1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of BRAF (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of human GSK3betaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of human Fyn expressed in Sf9 cells after 1 min by ELISA in presence of 1 umol/L ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of PRKG1 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of BRAF (unknown origin) after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of human FLT3 Y591-V592 mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1B(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of human CAMK1B using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of recombinant human Src expressed in insect cells using Ulight-Poly GAT[EAY(1:1:1)]n as substrate after 10 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C theta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of PKCtheta (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
TargetProtein kinase C theta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5nMAssay Description:Inhibition of PKCtheta (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.10nMAssay Description:Inhibition of GSK3beta (unknown origin) assessed as transfer of radiolabelled phosphate group from ATP by reaction biology methodMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 11(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.10nMAssay Description:Inhibition of human MLK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.10nMAssay Description:Inhibition of GSK3alpha (unknown origin) assessed as transfer of radiolabelled phosphate group from ATP by reaction biology methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin-IIIb(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.20nMAssay Description:Inhibition of human MYO3B using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.20nMAssay Description:Inhibition of GSK3BMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.20nMAssay Description:Inhibition of PDK1 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.30nMAssay Description:Inhibition of human GSK3B using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PAK 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.30nMAssay Description:Inhibition of human PAK5 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1G(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.30nMAssay Description:Inhibition of human CAMK1G using KKALRRQETVDAL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.40nMAssay Description:Inhibition of FLT1 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.40nMAssay Description:Inhibition of human MRCKalpha using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1A(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.40nMAssay Description:Inhibition of DYRK1A (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.40nMAssay Description:Inhibition of GSK3beta (unknown origin)More data for this Ligand-Target Pair
TargetPAS domain-containing serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.5nMAssay Description:Inhibition of human PASK using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 3(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.5nMAssay Description:Inhibition of human MST2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.5nMAssay Description:Inhibition of PKCdelta (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.5nMAssay Description:Inhibition of human CLK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.5nMAssay Description:Inhibition of human FLT3 ITD-NPOS mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.5nMAssay Description:Inhibition of human GSK3B using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetDual specificity protein kinase CLK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.60nMAssay Description:Inhibition of CLK2 (unknown origin) assessed as transfer of radiolabelled phosphate group from ATP by reaction biology methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.60nMAssay Description:Inhibition of human DAPK2 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.70nMAssay Description:Inhibition of human CHK2 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.80nMAssay Description:Inhibition of CDK2/cyclin A (unknown origin) after 60 mins by Z-LYTE kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.80nMAssay Description:Inhibition of FGFR2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.80nMAssay Description:Inhibition of recombinant His-tagged human TrKA expressed in baculovirus expression system by LanthaScreen assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetcGMP-dependent protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.80nMAssay Description:Inhibition of human PKG2 using LRRASLG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.94nMAssay Description:Inhibition of human AKT1 using KGSGSGRPRTSSFAEG as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of CDK1/cyclinBMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Rattus norvegicus)
Cephalon

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:In vitro inhibition of protein kinase C from rat brain.More data for this Ligand-Target Pair
In DepthDetails Article
TargetCyclin-C(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:In vitro ability to displace [125 I]CGRP from Calcitonin gene-related peptide type receptor at 4 degrees Celsius in rabbit porcine c+iMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRhodopsin kinase GRK7(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of human GRK7 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of human Aurora B using [H-LRRASLG] as substrate in presence of [gamma-33P]-ATP incubated for 2 hrs by hotspot kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of AKT1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of JAK3 expressed in Sf21 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of Calcium/calmodulin-dependent protein kinase type IIMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of human Aurora B using [H-LRRASLG] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of JAK3 expressed in insect Sf21 cells assessed as inhibition of biotinylated substrate phosphorylationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6nMAssay Description:Inhibition of VEGFR2 (unknown origin) using Tyr1 peptide as substrate after 1 hr by FRET-based assay in presence of 10 uM ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N2(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.10nMAssay Description:Inhibition of human PKN2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.14nMAssay Description:Shown are the IC50s (concentrations causing 50% inhibition) of DM and the analogues for the in vitro kinase assays using the following purified human...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCytoplasmic tyrosine-protein kinase BMX(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.20nMAssay Description:Inhibition of human BMX using poly[Glu:Tyr](4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.20nMAssay Description:Inhibition of IRAK4 (unknown origin)More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Gallus gallus (Chicken))
Chemical Genomics Centre of The Max Planck Society

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.30nM Kd:  8nMAssay Description:Tyrosine kinase inhibition assay using wild type cSrc measured by a fluorescence-labeled approach.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.30nMAssay Description:Inhibition of human FLT1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.30nMAssay Description:Inhibition of FGFR1 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.40nMAssay Description:Inhibition of human FGFR3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin-IIIb(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.40nMAssay Description:Inhibition of human MYO3B using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.5nMAssay Description:In vitro inhibition of Protein Kinase AMore data for this Ligand-Target Pair
In DepthDetails
Target3-phosphoinositide-dependent protein kinase 1 [51-359](Homo sapiens (Human))
University of Dundee

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.5nMpH: 7.5 T: 2°CAssay Description:In vitro PDK1 assay using purified enzyme, was incubated with substrate PDKtide, and test compounds in the presence of ATP/ [gamma-32P] ATP. 32P inco...More data for this Ligand-Target Pair
TargetRAC-beta serine/threonine-protein kinase(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.5nMpH: 7.5 T: 2°CAssay Description:The kinase assay uses His-Akt1 and a biotinylated peptide as substrate. The biotinylated peptides were immobilized on streptavidin-coated FLASH plat...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.5nMAssay Description:Inhibition of ALK (unknown origin) pre-incubated for 10 mins followed by substrate addition measured after 60 mins in presence of ATP by mobility shi...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.60nMpH: 7.4 T: 2°CAssay Description:The kinase assay uses purified recombinant enzyme and a biotinylated peptide as substrate. The biotinylated peptides were immobilized on streptavidi...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.70nMAssay Description:Inhibition of CHK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.70nMAssay Description:Inhibition of ALK (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G1/S-specific cyclin- 1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.80nMAssay Description:Inhibition of human CDK1/cyclinE using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.80nMAssay Description:Inhibition of human SGK1 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.80nMAssay Description:Inhibition of human PKAcg using KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.90nMAssay Description:Inhibition of CDK3/Cyclin EMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.90nMAssay Description:Inhibition of human STK38 using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 10(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.90nMAssay Description:Inhibition of human LOK using RLGRDKYKTLRQIRQ as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7nMAssay Description:Inhibition of human Aurora B using H-LRRASLG as substrate after 2 hrs by HotSpot assay in presence of 33P-ATP and 10 uM ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTestis-specific serine/threonine-protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7nMAssay Description:Inhibition of human TSSK3 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7nMAssay Description:Inhibition of human AKT1 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.10nMAssay Description:Inhibition of ALK (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase CSK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.10nMAssay Description:Inhibition of human CSK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.10nMAssay Description:Inhibition of ALK (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK4(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.20nMAssay Description:Inhibition of human PLK4 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.30nMAssay Description:Inhibition of human DAPK2 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.30nMAssay Description:Inhibition of human PKCb1 using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 15(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.30nMAssay Description:Inhibition of MAPK15 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.40nMAssay Description:Inhibition of human ZAP70 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.40nMAssay Description:Inhibition of FGFR2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.5nMAssay Description:Inhibition of human CLK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor-related protein(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.60nMAssay Description:Inhibition of human IRR using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.60nMAssay Description:Inhibition of human MEKK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.60nMAssay Description:Inhibition of Aurora A (unknown origin) after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.70nMAssay Description:Inhibition of human AXL using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.80nMAssay Description:Inhibition of human PKN3 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.80nMAssay Description:Inhibition of ROCK2 (unknown origin) by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.80nMAssay Description:Inhibition of Aurora B (unknown origin) using STK S2 as substrate after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8nMAssay Description:Inhibition of Cyclin-dependent kinase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSNF-related serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8nMAssay Description:Inhibition of human SNRK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 15(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8nMAssay Description:Inhibition of human ERK7 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 1(Mus musculus)
Johnson & Johnson Pharmaceutical Research & Development

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8nMAssay Description:Inhibition of Cyclin-dependent kinase 1 in P19 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8nMAssay Description:Inhibition of JAK3 (unknown origin) incubated for 40 mins in presence of Mg/ATP mix by [gamma p33]-ATP based scintillation counting methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 1(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8nMAssay Description:Inhibition of ARK5 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8nMAssay Description:Inhibition of aurora-B (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  8nMAssay Description:Inhibition of VEGFR2 after 60 mins by electrophoretic mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fes/Fps(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.10nMAssay Description:Inhibition of FES (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.10nMAssay Description:Inhibition of MEK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.20nMAssay Description:Inhibition of protein kinase AMore data for this Ligand-Target Pair
In DepthDetails
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.20nMAssay Description:Inhibition of VEGFR1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 6(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.30nMAssay Description:Inhibition of human MKK6 using p38alpha as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 2-beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.40nMAssay Description:Inhibition of human PYK2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.5nMAssay Description:Inhibition of IRMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.5nMAssay Description:Inhibition of human EPHA4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.60nMAssay Description:Inhibition of ZAP70 using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase LATS2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.60nMAssay Description:Inhibition of human LATS2 using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.70nMAssay Description:Inhibition of BRAF (unknown origin) by Lanthascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.80nMAssay Description:Inhibition of recombinant human Src using Ulight-Poly GAT[EAY(1:1:1)]n as substrate measured after 10 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.80nMAssay Description:Inhibition of BRAF V600E mutant (unknown origin) incubated for 40 mins in presence of Mg/ATP mix by [gamma p33]-ATP based scintillation counting meth...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.80nMAssay Description:Inhibition of human IR using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.90nMAssay Description:Inhibition of human DAPK1 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.90nMAssay Description:The reaction procedure was conducted as follows:1) Prepare substrate in freshly prepared Reaction Buffer.2) MnCl2 (2 mM) was added as a co-factor lis...More data for this Ligand-Target Pair
In DepthDetails US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.90nMAssay Description:Antihistaminic activity against Histamine H1 receptor was measured on isolated terminal part of guinea pig ileumMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase 10(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:Inhibition of human LOK using RLGRDKYKTLRQIRQ as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:Inhibition of human ULK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Rattus norvegicus (rat))
University of California San Diego

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:The activity of PKC, activated by phosphatidylserine and Ca2+, is measured by its ability to transfer phosphate from [gamma-32P]ATP to lysine-rich hi...More data for this Ligand-Target Pair
In DepthDetails Article
TargetProtein kinase C beta type(Rattus norvegicus (rat))
University of California San Diego

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMpH: 7.5 T: 2°CAssay Description:The activity of PKC, activated by phosphatidylerine and Ca2+, is measured by its ability to transfer phosphate from [gamma-32P]ATP to lysine-rich his...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Rattus norvegicus (rat))
University of California San Diego

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMpH: 7.5 T: 2°CAssay Description:The activity of PKC, activated by phosphatidylerine and Ca2+, is measured by its ability to transfer phosphate from [gamma-32P]ATP to lysine-rich his...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:Inhibition of ROCK2 (unknown origin) using SKT S2 as substrate measured after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:In vitro for inhibitory activity against protein kinase C from rat brainMore data for this Ligand-Target Pair
TargetSTE20-like serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:Inhibition of human SLK using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:Inhibition of FGFR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLysine--tRNA ligase(Homo sapiens (Human))
Yunnan University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  9nMAssay Description:Inhibition of human SykMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:Inhibition of AKT1 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-beta serine/threonine-protein kinase(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9nMAssay Description:Inhibition of AKT2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 15(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.10nMAssay Description:Inhibition of human ERK7 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.10nMAssay Description:Inhibition of human FAK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek1(Homo sapiens (Human))
Technische Universit£T Darmstadt

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.10nMAssay Description:Inhibition of human NEK1 using myelin basic protein as substrate assessed as residual activity in presence of [gamma-33P]-ATP by radiometric hotspot ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.20nMAssay Description:Inhibition of human CDK6/cyclin-D1 using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.20nMAssay Description:Inhibition of human CHK2 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.20nMAssay Description:Inhibition of GSK3-betaMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek1(Homo sapiens (Human))
Technische Universit£T Darmstadt

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.20nMAssay Description:Inhibition of human NEK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.30nMAssay Description:Inhibition of human SGK1 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.30nMAssay Description:Inhibition of FGFR3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.40nMAssay Description:Inhibition of human DAPK1 using KKLNRTLSFAEPG as substrate in presence of [gamma-33P]-ATPMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK4(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.5nMAssay Description:Inhibition of human PLK4 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.70nMAssay Description:Inhibition of human Src kinase by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMpH: 7.5 T: 2°CAssay Description:The kinase assay uses His-Akt1 and a biotinylated peptide as substrate. The biotinylated peptides were immobilized on streptavidin-coated FLASH plat...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of human ITK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of Protein kinase C beta 2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of human Protein kinase C beta 2 using [gamma-33P]-ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase, smooth muscle(Gallus gallus (chicken))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMpH: 7.2 T: 2°CAssay Description:The activity of MLCK is measured by its ability to transfer 32P from [gamma-32P]ATP to myosin light-chain.More data for this Ligand-Target Pair
In DepthDetails Article
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMpH: 7.6 T: 2°CAssay Description:A coupled-enzyme assay was used to quantify the ADP generated in the kinase reaction with S6 peptide (RRRLSSLRA) as the phosphoacceptorsubstrate.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of FGFR3 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of Akt3 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of VEGFR2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of human recombinant Pim1 expressed in insect cells by HTRFMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Rattus norvegicus)
Cephalon

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of protein kinase CMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of GSK-3beta (unknown origin)More data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Inhibition of PDK1 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
TargetMyosin light chain kinase, smooth muscle(Homo sapiens (Human))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:Tested for inhibition of Myosin light chain kinase from chicken gizzardMore data for this Ligand-Target Pair
In DepthDetails Article
TargetMyosin light chain kinase, smooth muscle(Gallus gallus (chicken))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10nMAssay Description:In vitro for inhibitory activity against myosin light-chain kinase from chicken gizzard (M-kinase)More data for this Ligand-Target Pair
In DepthDetails Article
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10.1nMAssay Description:Inhibition of human ABL2 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10.1nMAssay Description:Inhibition of human MEK5 using ERK5 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10.3nMAssay Description:Inhibition of human ULK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10.3nMAssay Description:Inhibition of human EPHA5 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10.6nMAssay Description:Inhibition of human Aurora B using [H-LRRASLG] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 2-beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10.6nMAssay Description:Inhibition of human PYK2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-Y/Cyclin-dependent kinase 17(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10.7nMAssay Description:Inhibition of human CDK17/cyclin-Y using MBP protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  10.9nMAssay Description:Inhibition of human MEKK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCytochrome P450 11B2, mitochondrial(Homo sapiens (Human))
Saarland University And Helmholtz Institute For Pharmaceutical Research Saarland (Hips)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of human aldosterone synthase expressed in V79 MZ cells assessed as inhibition of aldosterone synthesisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of AKT1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1A(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of DYRK1A (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of human AXL using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of MLK1 (unknown origin) by NanoBRET cellular target engagement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-G-associated kinase(Homo sapiens (Human))
Ku Leuven

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of tracer 222 binding to GAK (unknown origin) incubated for 1 hr by Lanthascreen TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of FAK (unknown origin) by Lanthascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of recombinant AKT1 (unknown origin) using serine/threonine 06 peptide as substrate after 1 hr by FRET based Z'-LYTE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of GSK3-beta by colorimetric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of human N-terminal His-tagged phosphorylated VEGFR2 in presence of ATP measured without preincubation by AlphaScreen analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of EGFR L858R mutant (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of VEGFR2 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of human AurA kinase by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 14(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11nMAssay Description:Inhibition of p38alpha (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.3nMAssay Description:Inhibition of human MSK2 using GRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.4nMAssay Description:Inhibition of human DYRK3 using RRRFRPASPLRGPPK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Mer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.6nMAssay Description:Inhibition of human c-MER using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.6nMAssay Description:Inhibition of human CDK6/cyclin-D1 using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.7nMAssay Description:Inhibition of human KDR using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.7nMAssay Description:Inhibition of human TAOK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase 24(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.8nMAssay Description:Inhibition of human MST3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.8nMAssay Description:Inhibition of human EPHA6 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N2(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  11.9nMAssay Description:Inhibition of human PKN2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibition of human Akt1 by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibition of human PKCb1 using Histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibition of AKT1 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1/G1/S-specific cyclin-E2(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibition of Cyclin E-cyclin-dependent kinase 2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1A(RAT)
Shenyang Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibition of rat recombinant DYRK1A expressed in Escherichia coli using RRRFRPASPLRGPPK as substrate by ADP-Glo kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibitory activity against Cyclin D1-cyclin-dependent kinase 4 by measuring the phosphorylation of RbINGMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibition of Protein kinase C epsilonMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibition of GSK3More data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12nMAssay Description:Inhibition of MEK1 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12.0nMAssay Description:1H-pyrrolo[2,3-b]pyridine, 1H-pyrazolo[3,4-b]pyridine and 5H-pyrrolo[2,3-b]pyrazine series of compounds exhibited over >100 fold selective against Ja...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12.4nMAssay Description:Inhibition of human ZAP70 using poly[Glu:Tyr] (4:1) as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
TargetEphrin type-A receptor 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12.5nMAssay Description:Inhibition of human EPHA4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12.8nMAssay Description:Inhibition of human LATS1 using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  12.8nMAssay Description:1H-pyrrolo[2,3-b]pyridine, 1H-pyrazolo[3,4-b]pyridine and 5H-pyrrolo[2,3-b]pyrazine series of compounds exhibited over >100 fold selective against Ja...More data for this Ligand-Target Pair
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged EGFR L858R mutant (669 to 1210 residues) expressed in baculovirus expression system by competit...More data for this Ligand-Target Pair
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13nMAssay Description:Inhibition of human FAK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13nMAssay Description:Inhibition of BTK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13nMAssay Description:Inhibition of DAPK1 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13nMAssay Description:Inhibition of JAK1 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13nMAssay Description:Inhibition of FAK (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13.1nMAssay Description:Inhibition of human DAPK1 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13.1nMAssay Description:Inhibition of human DAPK1 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase N3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13.2nMAssay Description:Inhibition of human PKN3 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13.3nMAssay Description:Inhibition of human LATS1 using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13.3nMAssay Description:Inhibition of human AKT3 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Oxford

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13.9nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 2, skeletal/cardiac muscle(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  13.9nMAssay Description:Inhibition of human MLCK2 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14nMAssay Description:Inhibition of Vascular endothelial growth factor receptor 2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14nMAssay Description:Inhibition of BRAF (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14nMAssay Description:Inhibition of KDRMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14nMAssay Description:Inhibition of SGK (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Oxford

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14nMAssay Description:Inhibition of GST-tagged human CDK9/CycT1 (04 to 110 residues) assessed as reduction in ATP-dependent ULight-4E-BP1 (Thr37/Thr46) substrate peptide p...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14nMAssay Description:Inhibition of BRAF (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14.2nMAssay Description:Inhibition of human CLK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase CSK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14.3nMAssay Description:Inhibition of human CSK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetSTE20/SPS1-related proline-alanine-rich protein kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14.4nMAssay Description:Inhibition of human STK39 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20-like serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14.6nMAssay Description:Inhibition of human SLK using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14.6nMAssay Description:Inhibition of human MEK2 using ERK2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  14.7nMAssay Description:Inhibition of human FLT1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of FGFR3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of IR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of PKA (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGlycogen synthase kinase-3 beta(Rattus norvegicus (rat))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15nMAssay Description:Antagonist activity in rat uterus by uterotonic assayMore data for this Ligand-Target Pair
TargetCyclin-C(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of GST-tagged human CDK8/CycC (04 to 109 residues) using kinase tracer 236 probe incubated for 60 mins by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of human GSK-3beta using YRRAAVPPSPSLSRHSSPHQS(p) EDEEE substrate peptide and [gamma-33P-ATP] incubated for 40 mins by scintillation count...More data for this Ligand-Target Pair
TargetInsulin receptor-related protein(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of human IRR using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of human GSK3betaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of Aurora A (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  15nMAssay Description:Inhibition of human Fyn expressed in Sf9 cells after 20 mins by ELISA in presence of 1 umol/L ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk2(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15.2nMAssay Description:Inhibition of human SGK2 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15.4nMAssay Description:Inhibition of human CDK6/cyclin-D3 using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 2, skeletal/cardiac muscle(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15.5nMAssay Description:Inhibition of human MLCK2 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 19(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15.6nMAssay Description:Inhibition of human YSK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15.7nMAssay Description:Inhibition of human DAPK1 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15.7nMAssay Description:Inhibition of human CAMKK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPAS domain-containing serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15.8nMAssay Description:Inhibition of human PASK using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  15.8nMAssay Description:Inhibition of human ABL2 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16nMAssay Description:Inhibition of FGFR3 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-beta serine/threonine-protein kinase(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16nMAssay Description:Inhibition of Akt2 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16nMAssay Description:Inhibition of VEGFR2 (unknown origin) using biotin substrate incubated for 1 hr by HTRF methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16nMAssay Description:Inhibition of Protein kinase AMore data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16nMAssay Description:Inhibition of human FLT1 by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16nMAssay Description:Inhibition of human IRAK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16nMAssay Description:Inhibition of FGFR3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-Y/Cyclin-dependent kinase 17(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16.3nMAssay Description:Inhibition of human CDK17/cyclin-Y using MBP protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16.5nMAssay Description:Inhibition of human SGK2 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16.7nMAssay Description:Inhibition of human FGFR3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C iota type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  16.7nMAssay Description:Inhibition of human PKCiota using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17nMAssay Description:Inhibition of FAKMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17nMAssay Description:Inhibition of recombinant human GST-tagged PIM1 by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17nMAssay Description:Inhibition of C-terminal His6 tagged full length recombinant human CDK9/full length human Cyclin T1 expressed in baculovirus infected Sf21 cells usin...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17nMAssay Description:Inhibition of recombinant human EGFR T790M/L858R double mutant using poly (Glu,Tyr) 4:1 as substrate after 1 hr by ELISAMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase FRK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17nMAssay Description:Inhibition of human FRK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeucine-rich repeat serine/threonine-protein kinase 2(Homo sapiens (Human))
The University Of Sydney

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.1nMAssay Description:Inhibition of human LRRK2 using RLGRDKYKTLRQIRQ as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.2nMAssay Description:Inhibition of human MEK3 using p38alpha as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.2nMAssay Description:Inhibition of human BTK using KVEKIGEGTYGVVYK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-Y/Cyclin-dependent kinase 16(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.2nMAssay Description:Inhibition of human CDK16/cyclin-Y using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20/SPS1-related proline-alanine-rich protein kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.2nMAssay Description:Inhibition of human STK39 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase/endoribonuclease IRE2(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.4nMAssay Description:Inhibition of human ERN2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek8(Homo sapiens)
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.5nMAssay Description:Inhibition of human NEK8 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.6nMAssay Description:Inhibition of human ASK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.7nMAssay Description:Inhibition of human IR using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  17.9nMAssay Description:Inhibition of human MEK1 using ERK2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Bos taurus (bovine))
TBA

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:In vitro for inhibitory activity against cGMP-dependent protein kinase from bovine lung (G-kinase)More data for this Ligand-Target Pair
In DepthDetails Article
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of Protein kinase C epsilonMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of Aurora A (unknown origin) incubated for 1 hrs by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of Lck (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of recombinant N-terminal His-tagged AKT1 (unknown origin) expressed in Escherichia coli strain BL21-Codon Plus (DE3) using Ser/Thr 6 pept...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of Akt1 (unknown origin) after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of FGFR3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of Protein kinase C epsilonMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of CDK4/Cyclin D1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Bos taurus (bovine))
TBA

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:The activity of cGPK, activated by cGMP, is measured by its ability to transfer phosphate from [gamma-32P]ATP to histone.More data for this Ligand-Target Pair
In DepthDetails Article
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of recombinant Aurora A expressed in Escherichia coliMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of recombinant aurora kinase A (unknown origin) expressed in Escherichia coliMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  18nMAssay Description:Inhibition of human PKCgammaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18.1nMAssay Description:Inhibition of human BTK using KVEKIGEGTYGVVYK as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek1(Homo sapiens (Human))
Technische Universit£T Darmstadt

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18.4nMAssay Description:Inhibition of human NEK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 12(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  18.4nMAssay Description:Inhibition of human DLK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of Protein kinase C beta 2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of GSK3beta (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of human ROCK1 by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of FLT1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of Protein kinase C beta 2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1A(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of DYRK1A (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase haspin(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of human haspin using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase haspin(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of human haspin using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20-like serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of SLK (unknown origin) assessed as transfer of radiolabelled phosphate group from ATP by reaction biology methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeukocyte tyrosine kinase receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of human TYK1 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19nMAssay Description:Inhibition of human MNK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase TXK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19.1nMAssay Description:Inhibition of human TXK using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein odd-skipped-related 1(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19.1nMAssay Description:Inhibition of human OSR1 using RRHYYYDTHTNTYYLRTFGHNTRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMedMMDB

TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  19.9nMAssay Description:Inhibition of human ASK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetEphrin type-B receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  20nMAssay Description:Inhibition of human EPHB1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  20nMAssay Description:Inhibition of human FAK/PTK2 using poly[Glu:Tyr] (4:1) as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 3(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  20nMAssay Description:Inhibition of EPHA3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  20.3nMAssay Description:Inhibition of human MNK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetEphrin type-A receptor 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  20.3nMAssay Description:Inhibition of human EPHA6 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  20.3nMAssay Description:Inhibition of human CDK4/cyclinD1 using RB-CTF as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21nMAssay Description:Inhibition of FGFR1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21.1nMAssay Description:Inhibition of human CDK4/cyclin-D1 using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21.5nMAssay Description:Inhibition of human EPHA5 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-beta serine/threonine-protein kinase(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21.5nMAssay Description:Inhibition of human AKT2 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase TXK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21.6nMAssay Description:Inhibition of human TXK using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21.7nMAssay Description:Inhibition of human TLK1 using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21.7nMAssay Description:Inhibition of human PIM2 using RSRHSSYPAGT as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21.7nMAssay Description:Inhibition of human ABL1 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 26(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  21.9nMAssay Description:Inhibition of human MST4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  22nMAssay Description:Inhibition of Aurora-AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 4(Homo sapiens (Human))
Inner Mongolia Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  22nMAssay Description:Inhibition of human PAK4 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  22nMAssay Description:Inhibition of Pim1 kinase (unknown origin) using substrate S3 after 50 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  22.1nMAssay Description:1H-pyrrolo[2,3-b]pyridine, 1H-pyrazolo[3,4-b]pyridine and 5H-pyrrolo[2,3-b]pyrazine series of compounds exhibited over >100 fold selective against Ja...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetSerine/threonine-protein kinase MAK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  22.7nMAssay Description:Inhibition of human MAK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Oxford

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  23nMAssay Description:Inhibition of CDK9/cyclin T1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  23nMAssay Description:Inhibition of Protein kinase C beta 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  23nMAssay Description:Inhibition of Protein kinase C beta 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  23nMAssay Description:Inhibition of recombinant human Aurora-A using Ulight-RRRSLLE as substrate measured after 15 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  23.3nMAssay Description:Inhibition of human CDK4/cyclin-D1 using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  23.3nMAssay Description:Inhibition of human BTK using KVEKIGEGTYGVVYK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  23.5nMAssay Description:Inhibition of human MEKK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  23.9nMAssay Description:Inhibition of human MEK1 using ERK2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  24nMAssay Description:Inhibition of human MEK1 by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  24nMAssay Description:Inhibition of GSK-3beta (unknown origin) using FAM-labeled peptide as substrate preincubated for 10 mins followed by substrate addition by caliper as...More data for this Ligand-Target Pair
TargetCyclin-Y/Cyclin-dependent kinase 16(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  24nMAssay Description:Inhibition of human CDK16/cyclin-Y using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  24nMAssay Description:Inhibition of GSK3b (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
TargetSRSF protein kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  24.5nMAssay Description:Inhibition of human SRPK1 using GRSRSRSRSR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Tec(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  24.6nMAssay Description:Inhibition of human TEC using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  24.6nMAssay Description:Inhibition of human GRK5 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  24.9nMAssay Description:Inhibition of human ACK1 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  25nMAssay Description:Inhibition of recombinant human CDK1/Cyclin B expressed in insect cells using Ulight-CFFKNIVTPRTPPPSQGK-amide as substrate after 15 mins by LANCE met...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32B(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  25.8nMAssay Description:Inhibition of human STK32B using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17B(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  26nMAssay Description:Inhibition of Drak2 (unknown origin) by ADP-GLO kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  26nMAssay Description:Inhibition of Aurora B (unknown origin) incubated for 1 hrs by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  26.5nMAssay Description:Inhibition of human PKG2 using LRRASLG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  26.7nMAssay Description:Inhibition of human EGFR using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  27nMAssay Description:Competitive inhibition of human CHK2 using ATP as substrate by DELFIAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Rattus norvegicus (rat))
Nova Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  27nMAssay Description:Inhibition of cAMP-dependent kinase PKA(Protein kinase A) catalytic subunit at 100 uMMore data for this Ligand-Target Pair
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  27nMAssay Description:Inhibition of MNK2 (unknown origin)More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  27nMAssay Description:Inhibition of human CHK2 kinase expressed in insect Sf21 cells using phospho-CREBtide as substrate at 30 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1/2/3/4(Homo sapiens (Human))
Egyptian National Research Centre

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  27nMAssay Description:Inhibition of FGFR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  27nMAssay Description:Inhibition of full length human CDK4/N-terminal GST fused human cyclinD3 expressed in baculovirus expression system using 5-FAMIPTSPITTTYFFFKKK-COOH ...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  27.5nMAssay Description:Inhibition of human IGF1R using KKKSPGEYVNIEFG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  27.6nMAssay Description:Inhibition of human ERBB2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 4(Homo sapiens (Human))
Inner Mongolia Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  27.9nMAssay Description:Inhibition of human PAK4 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  28nMAssay Description:Inhibition of Protein kinase C deltaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  28nMAssay Description:Inhibition of Protein kinase C alphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  28nMAssay Description:Inhibition of HER4 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  28nMAssay Description:Inhibition of human recombinant GSK3alpha using CFFKNIVTPRTPPPSQGK-amide substrate after 60 mins incubation by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  28nMAssay Description:Inhibition of Protein kinase C deltaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  28nMAssay Description:Inhibition of Pim2 kinaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  28nMAssay Description:Inhibition of human Protein kinase C alpha using [gamma-33P]-ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  28.1nMAssay Description:Inhibition of human CDK4/cyclin-D3 using RB-CTF as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MAK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  28.7nMAssay Description:Inhibition of human MAK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  29nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged HER4 (676 to 1308 residues) expressed in baculovirus expression system by competitive binding a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeukocyte tyrosine kinase receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  29.2nMAssay Description:Inhibition of human TYK1 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  29.8nMAssay Description:Inhibition of human CAMKK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  29.9nMAssay Description:Inhibition of human TIE2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  30nMAssay Description:Inhibition of CDK4/Cyclin D1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  30nMAssay Description:Inhibition of GSK3-beta (unknown origin) incubated for 60 mins by ATP-Glo luminescent assayMore data for this Ligand-Target Pair
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  30nMAssay Description:Inhibition of AKT1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  30nMAssay Description:Inhibition of human full length GSK3beta expressed in baculovirus in Sf9 insect cells using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate by ADP-Glo kin...More data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  30nMAssay Description:Inhibition of ALK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  30.4nMAssay Description:Inhibition of human TLK1 using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17A(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  30.4nMAssay Description:Inhibition of human DRAK1 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  30.4nMAssay Description:Inhibition of human TLK1 using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  31nMAssay Description:Inhibition of human PAK6 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  31nMAssay Description:Inhibition of recombinant human Pim1 expressed in bacterial expression system using histone H1 as substrate after 30 mins by ADP-Glo reagent based lu...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  31nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetDual serine/threonine and tyrosine protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  31.3nMAssay Description:Inhibition of human RIPK5 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17A(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  31.4nMAssay Description:Inhibition of human DRAK1 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C iota type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  31.6nMAssay Description:Inhibition of human PKCiota using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 3(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  31.9nMAssay Description:Inhibition of human EPHA3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  32nMAssay Description:Inhibition of recombinant human CDK1/Cyclin B using Ulight-CFFKNIVTPRTPPPSQGK-amide as substrate measured after 15 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  32nMAssay Description:Inhibition of BRAF V600E mutant (unknown origin) using Ser/Thr 03 as substrate after 1 hr in presence of ATP by Z'-LYTE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase haspin(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  32nMAssay Description:Inhibition of human haspin using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  32.2nMAssay Description:Inhibition of VEGFR2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  32.9nMAssay Description:Inhibition of human GRK6 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  33nMAssay Description:Inhibition of PKA activity using neurogranin as a substrate in presence of 50 uM ATP by mass spectrometryMore data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  33nMAssay Description:Inhibition of GSK3beta (unknown origin) assessed as luminescence intensity by luminometryMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  33.6nMAssay Description:Inhibition of human CAMKK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  33.6nMAssay Description:Inhibition of human CLK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  33.7nMAssay Description:Inhibition of human c-MET using KKKSPGEYVNIEFG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  34nMAssay Description:Inhibition of FGFR2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  34nMAssay Description:Inhibition of IRAK4More data for this Ligand-Target Pair
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  34nMAssay Description:Inhibition of recombinant human His-tagged HER2 cytoplasmic domain (676 to 1255 residues) expressed in baculovirus expression system using Poly (Glu,...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  34.5nMAssay Description:Inhibition of human PAK6 using RRRLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  34.8nMAssay Description:Inhibition of human DYRK3 using RRRFRPASPLRGPPK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  34.8nMAssay Description:Inhibition of human ACK1 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta-activated kinase 1 and MAP3K7-binding protein 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  35nMAssay Description:Inhibition of TAB1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 7(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  35nMAssay Description:Inhibition of TAK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  35nMAssay Description:Inhibition of ABL1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  35nMAssay Description:Inhibition of recombinant human Flt1 expressed in Sf9 insect cells using Ulight-TK peptide as substrate after 15 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  35.0nMAssay Description:Inhibition of IGF1RMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek8(Homo sapiens)
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  35.1nMAssay Description:Inhibition of human NEK8 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  36nMAssay Description:Inhibition of BTKMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  36nMAssay Description:Inhibition of human Fyn expressed in Sf9 cells after 1 min by ELISA in presence of 10 umol/L ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  36.3nMAssay Description:Inhibition of MAPKAPK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 33(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  36.3nMAssay Description:Inhibition of human STK33 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  36.4nMAssay Description:Inhibition of human TLK1 using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  37nMAssay Description:Inhibition of recombinant human GST-tagged wild type EGFR ( 668 to 1210 residues) cytoplasmic domain expressed in baculovirus expression system prein...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  37nMAssay Description:Inhibition of ASK1 (unknown origin) by luciferase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  37.1nMAssay Description:Inhibition of human CDK4/cyclin-D3 using RB-CTF as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  37.4nMAssay Description:Inhibition of human MEK2 using ERK2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  38nMAssay Description:The test methods for GSK-3β, PKCE, JAK2, BRAF, IKK2 and Drak2 inhibitory activities were reported in Molecules; 18:5498-5516. The PKA kinase ass...More data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  38nMAssay Description:Inhibition of recombinant GST-tagged GSK-3beta (unknown origin) expressed in Escherichia coli strain BL21-Codon Plus (DE3) using Ser/Thr 9 peptide su...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase 33(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  38.4nMAssay Description:Inhibition of human STK33 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ICK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  38.6nMAssay Description:Inhibition of human LCK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  39nMAssay Description:Inhibition of TNIK-mediated TCF4/beta-catenin transcription in human HCT116 cells by beta-lactamase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit alpha(Homo sapiens (Human))
Universidade Federal Do Rio De Janeiro

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  39nMAssay Description:Inhibition of human recombinant IKK-alpha expressed in insect Sf21 cells using phospho-Ulight-IkappaB-alpha as substrate at 30 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  39nMAssay Description:Inhibition of recombinant human Aurora-A expressed in Sf21 insect cells using Ulight-RRRSLLE as substrate after 15 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 11(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  39nMAssay Description:Inhibition of MLK3 (unknown origin) by NanoBRET cellular target engagement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  39nMAssay Description:Inhibition of recombinant human full-length His-tagged TAK1-TAB1 fusion protein (437 to 504 residues) expressed in baculovirus expression system usin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 3(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  39nMAssay Description:Inhibition of human EPHA3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  39.2nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  39.4nMAssay Description:Inhibition of human PKCzeta using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  39.9nMAssay Description:Inhibition of human EPHA2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Bos taurus (bovine))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  40nMAssay Description:In vitro for inhibitory activity against cAMP-dependent protein kinase from bovine heart (A-kinase)More data for this Ligand-Target Pair
TargetcAMP-dependent protein kinase catalytic subunit alpha(Bos taurus (bovine))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  40nMAssay Description:The activity of PKA, activated by cAMP, is measured by its ability to transfer phosphate from [gamma-32P]ATP to histone.More data for this Ligand-Target Pair
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  40nMAssay Description:Inhibition of Akt1 (unknown origin) using ATP/eNOS as substrate preincubated for 5 mins followed by substrate addition measured after 30 mins by fluo...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  40nMAssay Description:Inhibition of EGFR (unknown origin) incubated for 40 mins in presence of Mg/ATP mix by [gamma p33]-ATP based scintillation counting methodMore data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  40nMAssay Description:Inhibition of Protein kinase C beta 1More data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  40nMAssay Description:Inhibition of AXL (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin-IIIa(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  40.2nMAssay Description:Inhibition of human MYO3A using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  40.4nMAssay Description:Inhibition of human MEK5 using ERK5 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ICK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  41nMAssay Description:Inhibition of ICK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  41nMAssay Description:Inhibition of human PKCdeltaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  41nMAssay Description:The reaction procedure was conducted as follows:1) Prepare substrate in freshly prepared Reaction Buffer.2) MnCl2 (2 mM) was added as a co-factor lis...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  41nMAssay Description:Inhibition of EGFR ex19del mutant (unknown origin) in presence of radiolabelled gammaATP by radioisotope filter binding assayMore data for this Ligand-Target Pair
TargetRAC-beta serine/threonine-protein kinase(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  41.5nMAssay Description:Inhibition of human AKT2 using KGSGSGRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  42nMAssay Description:Inhibition of human CAMKK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  42.4nMAssay Description:Inhibition of human EPHB2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  42.8nMAssay Description:Inhibition of human SRPK1 using GRSRSRSRSR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  43nMAssay Description:Inhibition of IGF1R (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 7(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  43nMAssay Description:Inhibition of TAK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  43nMAssay Description:Inhibition of CDK4/Cyclin D3 (unknown origin) using FAM-labeled peptide as substrate preincubated for 10 mins followed by substrate addition measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetThioredoxin reductase 1, cytoplasmic(Homo sapiens (Human))
Alexandria University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  43nMAssay Description:Inhibition of TrxR1 (unknown origin) assessed as reduction in DTNB to TNB by colorimetric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Tec(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  43.1nMAssay Description:Inhibition of human TEC using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase, smooth muscle(Homo sapiens (Human))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  43.2nMAssay Description:Inhibition of human MLCK using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  43.5nMAssay Description:Inhibition of human MEKK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  44nMAssay Description:Inhibition of EGFR (unknown origin) by HTRF methodMore data for this Ligand-Target Pair
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  44nMAssay Description:Antihistaminic activity against Histamine H1 receptor was measured on isolated terminal part of guinea pig ileumMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetMyosin-IIIa(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  44.8nMAssay Description:Inhibition of human MYO3A using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha [T183A](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <45nMAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetcAMP-dependent protein kinase catalytic subunit alpha [E127D](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <45nMAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetcAMP-dependent protein kinase catalytic subunit alpha [Q181K,T183A](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <45nMAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetcAMP-dependent protein kinase catalytic subunit alpha [L49I,Q181K,T183A](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <45nMAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetcAMP-dependent protein kinase catalytic subunit alpha [V123M,Q181K,T183A](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <45nMAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetcAMP-dependent protein kinase catalytic subunit alpha [L49I,V123M,E127D,Q181K,T183A](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <45nMAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetcAMP-dependent protein kinase catalytic subunit alpha [V123M](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <45nMpH: 6.8 T: 2°CAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  45nMAssay Description:Inhibition of Protein kinase C alphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  45nMAssay Description:Inhibition of Protein kinase C alphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Bos taurus (bovine))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <45nMpH: 6.8 T: 2°CAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase/endoribonuclease IRE1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  45.3nMAssay Description:Inhibition of human ERN1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  45.8nMAssay Description:Inhibition of human MEK1 using ERK2 as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCell division cycle 7-related protein kinase/Protein DBF4 homolog A(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  46.3nMAssay Description:Inhibition of human CDC7/DBF4 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha [L49I](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  47nMpH: 6.8 T: 2°CAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  47nMAssay Description:Inhibition of recombinant human C-terminal His-tagged/N-terminal GST-tagged EGFR (668 to 1210 residues) expressed in baculovirus infected Sf9 cells u...More data for this Ligand-Target Pair
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  47.2nMAssay Description:Inhibition of human c-KIT using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  47.4nMAssay Description:Inhibition of human IGF1R using KKKSPGEYVNIEFG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  48nMAssay Description:Inhibition of EGFR (unknown origin) using FAM-labeled peptide as substrate preincubated for 10 mins followed by addition of substrate by mobility shi...More data for this Ligand-Target Pair
TargetEphrin type-A receptor 3(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  48nMAssay Description:Inhibition of EPHA3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  48nMAssay Description:Inhibition of LIMK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetSerine/threonine-protein kinase STK11(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  48.7nMAssay Description:Inhibition of human LKB1 using LSNLYHQGKFLQTFCGSPLYRRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor TYRO3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  49.0nMAssay Description:Inhibition of TYRO3/SKYMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor [538-678,753-922](Homo sapiens (Human))
Johnson & Johnson Pharmaceutical

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  49nMpH: 7.5 T: 2°CAssay Description:The full-length cFMS cytoplasmic domain (FMS.538-972.6His) or chimera was incubated with compound in reaction buffer. Control reactions were run in e...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  49nMAssay Description:Inhibition of Protein kinase C deltaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  49nMAssay Description:Inhibition of Epidermal growth factor receptorMore data for this Ligand-Target Pair
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  49nMAssay Description:Inhibition of Protein kinase C deltaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32B(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  49.1nMAssay Description:Inhibition of human STK32B using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  50nMAssay Description:Inhibition of human recombinant GSK3beta using CFFKNIVTPRTPPPSQGK-amide substrate after 90 mins incubation by LANCE methodMore data for this Ligand-Target Pair
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  50nMAssay Description:Inhibition of CDK6/Cyclin D3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetEphrin type-A receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  50nMAssay Description:Inhibition of EPHA1 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha [L49I,V123M,Q181K,T183A](Bos taurus (bovine))
German Cancer Research Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  51nMAssay Description:The enzyme activity was assayed by using an ATP regenerative NADH consuming system. The reaction was started with adding ATP to the mixture containin...More data for this Ligand-Target Pair
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  51nMAssay Description:Inhibition of TIE2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  51nMAssay Description:Inhibition of recombinant human HER2 incubated for 40 to 45 mins and measured after 15 mins by Kinase-Glo Max assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  51nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged EGFR (669 to 1210 residues) expressed in baculovirus expression system by competitive binding a...More data for this Ligand-Target Pair
TargetCyclin-Y/Cyclin-dependent kinase 18(Homo sapiens)
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  51.1nMAssay Description:Inhibition of human CDK18/cyclin-Y using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase, smooth muscle(Homo sapiens (Human))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  51.3nMAssay Description:Inhibition of human MLCK using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  52nMAssay Description:Inhibition of TIE2/TEKMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  52nMAssay Description:Inhibition of GSK3beta (unknown origin) after 60 mins by Z-LYTE kinase assayMore data for this Ligand-Target Pair
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  52.7nMAssay Description:Inhibition of human MNK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase family member 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  52.9nMAssay Description:Inhibition of human MYLK4 using KKRPQRRYSNVF as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 12(Homo sapiens)
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  53nMAssay Description:Inhibition of N-terminal FLAG-tagged human full-length CDK12 (1 to 1490 residues)/N-terminal His-tagged CycK (1 to 580 residues) expressed in Sf9 cel...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  53nMAssay Description:Inhibition of human ZAP70 expressed in Sf9 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  53nMAssay Description:Inhibition of human ZAP70More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  53nMAssay Description:Inhibition of recombinant full length human N-terminal GST-tagged GSK3beta (1 to 420 end residues) expressed in baculovirus expression system using u...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ICK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  53.3nMAssay Description:Inhibition of human LCK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  53.4nMAssay Description:Inhibition of human MNK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54nMAssay Description:In a typical assay, 10 µL of test compound of different concentrations (dissolved in dimethyl sulfoxide [DMSO] and diluted with assay buffer) and 10 ...More data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54nMAssay Description:Inhibition of recombinant human N-terminal His-tagged GSK-3beta expressed in Escherichia coli using glycogen synthase-2 as substrate and ATP measured...More data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54nMAssay Description:Inhibition Protein kinase C gammaMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54nMAssay Description:Inhibition of full length human recombinant CDK3/Cyclin E using histone H1 as substrate incubated for 40 mins in presence of [gamma-33ATP] by radiome...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17A(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54nMAssay Description:Inhibition of human N-terminal His-tagged/ TEV cleavage fused DRAK1 (39 to 369 residues) transfected in HEK293T cells using NanoBRET NanoGlo as subst...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54.1nMAssay Description:Inhibition of human ABL1 using EAIYAAPFAKKK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLymphokine-activated killer T-cell-originated protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54.3nMAssay Description:Inhibition of human PBK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMuscle, skeletal receptor tyrosine-protein kinase(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54.4nMAssay Description:Inhibition of human MUSK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase family member 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  54.5nMAssay Description:Inhibition of human MYLK4 using KKRPQRRYSNVF as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  55nMAssay Description:Inhibition of human FAK by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  55nMAssay Description:Inhibition of PDGFRbeta (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase NLK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  55.5nMAssay Description:Inhibition of human NLK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  56nMAssay Description:Inhibition of GST-GSK3betaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  56nMAssay Description:Inhibition of human Glycogen synthase kinase-3 betaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  56nMAssay Description:Inhibition of recombinant human AKT1 expressed in insect cells using CREBtide as substrate after 60 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBreakpoint cluster region protein/Tyrosine-protein kinase ABL1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  56nMAssay Description:Inhibition of BCR-ABL T315I mutant (unknown origin) incubated for 40 mins in presence of [gamma33P]ATP by scintillation methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  56.3nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor [538-972]()
Johnson & Johnson Pharmaceutical

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  57nMpH: 7.5 T: 2°CAssay Description:The full-length cFMS cytoplasmic domain (FMS.538-972.6His) or chimera was incubated with compound in reaction buffer. Control reactions were run in e...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor [538-678,753-922](Human Sapiens (Human))
Johnson & Johnson Pharmaceutical

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  57nMpH: 7.5 T: 2°CAssay Description:The full-length cFMS cytoplasmic domain (FMS.538-972.6His) or chimera was incubated with compound in reaction buffer. Control reactions were run in e...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  57nMAssay Description:Inhibition of c-Met (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  57nMAssay Description:Inhibition of cMET (unknown origin) using FAM-labeled peptide as substrate pre-incubated for 5 to 10 mins followed by substrate addition and measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 13/Cyclin-K(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  57nMAssay Description:Inhibition of N-terminal FLAG-tagged human full-length CDK13 (1 to 1512 residues)/N-terminal His-tagged CycK (1 to 580 residues) expressed in Sf9 cel...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRhodopsin kinase GRK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  57.8nMAssay Description:Inhibition of human GRK1 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  58nMAssay Description:Inhibition of PIM1 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  59nMAssay Description:Inhibition of Protein kinase C gammaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  59nMAssay Description:Inhibition of human Protein kinase C gamma using [gamma-33P]-ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  59nMpH: 7.0 T: 2°CAssay Description:In vitro CDK assay using purified enzyme, was incubated at room temperature with substrate, and test compounds in the presence of ATP/[gamma-33P]ATP....More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  59nMAssay Description:Inhibition of Cyclin B-cyclin-dependent kinase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  59nMAssay Description:Inhibition of EGFR L858R mutant (unknown origin) in presence of radiolabelled gammaATP by radioisotope filter binding assayMore data for this Ligand-Target Pair
TargetInterleukin-1 receptor-associated kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  59.3nMAssay Description:Inhibition of human IRAK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  60nMT: 2°CAssay Description:In a typical assay, 10 µL of test compound of different concentrations (dissolvedin dimethyl sulfoxide [DMSO] and diluted with assay buffer) and 10 µ...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  60nMAssay Description:Inhibition of SYK (unknown origin)More data for this Ligand-Target Pair
TargetEphrin type-B receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  60.3nMAssay Description:Inhibition of human EPHB1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  61nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged HER2 (679 to 1255 residues) expressed in baculovirus infected Sf9 cells using Poly-(Glu, Tyr) a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein odd-skipped-related 1(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  61.3nMAssay Description:Inhibition of human OSR1 using RRHYYYDTHTNTYYLRTFGHNTRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMedMMDB

TargetG protein-coupled receptor kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  61.7nMAssay Description:Inhibition of human GRK6 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  62nMAssay Description:Inhibition of full length human recombinant CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33ATP] by radiome...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  62nMAssay Description:Inhibition of recombinant human FAK expressed in Sf9 insect cells using Ulight-TK peptide as substrate after 60 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  63nMAssay Description:Inhibition of human Protein kinase C beta 1 using [gamma-33P]-ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  63nMAssay Description:Inhibition of Protein kinase C beta 2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit alpha(Homo sapiens (Human))
Universidade Federal Do Rio De Janeiro

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  63nMAssay Description:Inhibition of IKKalpha (unknown origin) by ADP-Glo kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCell division cycle 7-related protein kinase/Protein DBF4 homolog A(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  63.4nMAssay Description:Inhibition of human CDC7/DBF4 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  64nMAssay Description:Inhibition of human recombinant GSK3 beta H350L mutant using YRRAAVPPSPSLSR as substrate incubated for 40 mins in presence of [gamma-33ATP] by radiom...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  65nMAssay Description:Inhibition of BTK (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  65nMAssay Description:Inhibition of cKITMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual serine/threonine and tyrosine protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  65.2nMAssay Description:Inhibition of human RIPK5 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  65.5nMAssay Description:Inhibition of human TIE2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase/endoribonuclease IRE2(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  65.8nMAssay Description:Inhibition of human ERN2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  65.9nMAssay Description:Inhibition of human MAPKAPK2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetRetinoblastoma-associated protein(Homo sapiens (Human))
Padmashri Vikhe Patil College of Arts

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  66nMAssay Description:Inhibition of retinoblastoma protein phosphorylation in human MDA-MB-231 cells after 16 hrs by Hoechst 33342 staining based fluorescence assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 7(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  66.2nMAssay Description:Inhibition of human TAK1 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 18(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  66.3nMAssay Description:Inhibition of human CDK18/cyclin-Y using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  67nMAssay Description:Inhibition of human recombinant TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma-33ATP] by rad...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  68nMAssay Description:Inhibition of recombinant human GST-tagged EGFR cytoplasmic domain (668 to 1210 residues) expressed in baculovirus expression system using Poly (Glu,...More data for this Ligand-Target Pair
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  69nMAssay Description:Inhibition of c-Met (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual serine/threonine and tyrosine protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  69nMAssay Description:Inhibition of human RIPK5 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual serine/threonine and tyrosine protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  69nMAssay Description:Inhibition of human RIPK5 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  69.6nMAssay Description:Inhibition of human SGK3 using GRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  69.9nMAssay Description:Inhibition of human GRK4 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  70nMAssay Description:Inhibition of Src protein tyrosine kinaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  70nMAssay Description:Inhibition of VEGFR2 in HUE cells assessed as inhibition of VEGF-induced autophosphorylation treated for 90 mins before VEGF challenge by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit alpha(Homo sapiens (Human))
Universidade Federal Do Rio De Janeiro

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  70.7nMAssay Description:Inhibition of human IKKalpha using KKKKERLLDDRHDSGLDSMKDEE as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase STK11(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  70.9nMAssay Description:Inhibition of human LKB1 using LSNLYHQGKFLQTFCGSPLYRRR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNADPH oxidase 4(Homo sapiens (Human))
Alexandria University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  71nMAssay Description:Inhibition of human NADPH oxidase 4 by quantitative sandwich enzyme immunoassay techniqueMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  71nMAssay Description:Inhibition of human NEK9 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  72nMAssay Description:Inhibition of VEGFR2 (unknown origin) using FAM-labeled peptide as substrate preincubated for 10 mins followed by substrate addition by mobility shif...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  72nMAssay Description:Inhibition of VEGFR2 (unknown origin) by mobility shift/LanthaScreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  72nMAssay Description:Inhibition of recombinant full length human C-terminal His6-tagged CDK7/untagged recombinant full length human Cyclin H/N-terminal GST-tagged recombi...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  72nMAssay Description:Inhibition of VEGFR2 (unknown origin) incubated for 10 mins using FAM-labeled peptide and ATP by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  72.7nMAssay Description:Inhibition of human c-KIT using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 10(Homo sapiens (Human))
Korea Institute Of Science And Technology

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  73nMAssay Description:Inhibition of JNK3 (unknown origin) incubated for 40 mins in presence of Mg/ATP mix by [gamma p33]-ATP based scintillation counting methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  73.3nMAssay Description:Inhibition of human GRK5 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  74nMAssay Description:Inhibition of INSR (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  74nMAssay Description:Inhibition of EGFR (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  74.2nMAssay Description:Inhibition of human NEK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  74.5nMAssay Description:Inhibition of human EPHA2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  75nMAssay Description:The inhibitory activities of compounds of Formula I were assay at Reaction Biology Corporation, One Great Valley Parkway, Malvern, Pa., USA. Human ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetEphrin type-A receptor 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  75.2nMAssay Description:Inhibition of human EPHA8 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase haspin(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  75.6nMAssay Description:Inhibition of human haspin using Histone H3 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  76nMAssay Description:Inhibition of ARG (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  76nMAssay Description:Inhibition of human ABL1 using EAIYAAPFAKKK as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  76.3nMAssay Description:Inhibition of human NEK5 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  76.5nMAssay Description:Inhibition of human SGK3 using GRPRTSSFAEG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCDK-activating kinase assembly factor MAT1/Cyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  76.6nMAssay Description:Inhibition of human CDK7/cyclin-H/MNAT1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  76.8nMAssay Description:Inhibition of human PKCzeta using ERMRPRKRQGSVRRRV as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  76.9nMAssay Description:Inhibition of human PLK1 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  77nMAssay Description:Inhibition of IL-8 release by HEK293 cells expressing PKC-beta2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  77nMAssay Description:Inhibition of Glycogen synthase kinase-3 betaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage-stimulating protein receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  77.2nMAssay Description:Inhibition of human RON using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase NLK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  77.8nMAssay Description:Inhibition of human NLK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  77.9nMAssay Description:Inhibition of human FGFR4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  78nMAssay Description:Inhibition of EGFR (unknown origin) using FAM-labeled peptide as substrate preincubated for 10 mins followed by substrate addition measured after 60 ...More data for this Ligand-Target Pair
TargetRhodopsin kinase GRK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  78.1nMAssay Description:Inhibition of human GRK1 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 12(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  78.7nMAssay Description:Inhibition of human p38gamma using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBreakpoint cluster region protein/Tyrosine-protein kinase ABL1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  79nMAssay Description:Inhibition of wild type BCR-ABL (unknown origin) incubated for 40 mins in presence of [gamma33P]ATP by scintillation methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  80nMpH: 7.5 T: 2°CAssay Description:NSC 109555 was diluted in water. All other drugs were dissolved in DMSO, in which case the final DMSO concentration in reactions was 10%, and the con...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  80nMAssay Description:Inhibition of FAK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  80nMAssay Description:Inhibition of protein kinase A (PKA)More data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  80nMAssay Description:Inhibition of Vascular endothelial growth factor receptor 2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 13(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  81nMAssay Description:Inhibition of human p38delta using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  83nMAssay Description:Inhibition of human Fyn expressed in Sf9 cells after 20 mins by ELISA in presence of 10 umol/L ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Mer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  83nMAssay Description:Inhibition of MERTK (unknown origin) using EFPIYDFLPAKKK-CONH2 as substrate and ATP after 180 mins by microfluidic capillary electrophoresis methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  83.5nMAssay Description:Inhibition of human DCAMKL2 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLymphokine-activated killer T-cell-originated protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  83.9nMAssay Description:Inhibition of human PBK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  84nMAssay Description:Inhibition of cKit (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  84nMAssay Description:Inhibition of c-Kit (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  85nMAssay Description:Inhibition of IGF1RMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  89nMAssay Description:Inhibition of Glycogen synthase kinase-3 betaMore data for this Ligand-Target Pair
TargetLIM domain kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  89.2nMAssay Description:Inhibition of human LIMK2 using cofilin as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  90nMAssay Description:Inhibition of cMET (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  90nMAssay Description:Inhibition of recombinant c-MET (unknown origin) using poly (Glu, Tyr) 4:1 as substrate after 45 mins by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  90.4nMAssay Description:Inhibition of human CDK6/cyclin-D3 using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  90.8nMAssay Description:Inhibition of human MEKK6 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase NIM1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  91.5nMAssay Description:Inhibition of human NIM1 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  94.4nMAssay Description:Inhibition of human DCAMKL2 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  95.3nMAssay Description:Inhibition of human EPHA1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  96nMAssay Description:Inhibition of human NEK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  96.5nMAssay Description:Inhibition of human NEK5 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 7(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  99nMAssay Description:Inhibition of human TAK1 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SBK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  99.8nMAssay Description:Inhibition of human SBK1 using LCGRTGRRNSI as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  100nMAssay Description:Inhibition of N-terminal GST-tagged full length human BTK (2 to 659 residues) expressed in Sf21 insect cells using 5-FAM-EAIYAAPFAKKK as substrate in...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  100nMAssay Description:Inhibitory activity against protein tyrosine kinase of Epidermal growth factor receptor was determinedMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  100nMAssay Description:Inhibition of CDK5/p25 (unknown origin)-mediated incorporation of gamma33P into substrate after 20 mins by scintillation counting analysis in presenc...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1/ABL2(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  100nMAssay Description:Inhibition of Abl tyrosine kinaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <100nMAssay Description:Concentration that inhibits the binding of radioligand, [3H]-ICS 205930, to 5-hydroxytryptamine 3 receptor from rat cortexMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-Y(Homo sapiens)
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  101nMAssay Description:Inhibition of human CDK14/cyclin-Y using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  102nMAssay Description:Inhibition of human LIMK2 using cofilin as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  102nMAssay Description:Inhibition of EGFRMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage-stimulating protein receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  103nMAssay Description:Inhibition of RON (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  103nMAssay Description:Inhibition of c-MetMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  104nMAssay Description:Inhibition of HER2 (unknown origin) in presence of radiolabelled gammaATP by radioisotope filter binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyotonin-protein kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  105nMAssay Description:Inhibition of human DMPK using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  106nMAssay Description:Inhibition of Abl1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  107nMAssay Description:Inhibition of human FGFR4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCDK-activating kinase assembly factor MAT1/Cyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  107nMAssay Description:Inhibition of CDK7/cyclin H/MAT1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  108nMAssay Description:Inhibition of human ERBB2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  110nMAssay Description:Inhibition of PIM1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  110nMAssay Description:Inhibition of Protein kinase C gammaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  110nMAssay Description:Inhibition of Protein kinase C gammaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  111nMAssay Description:Inhibition of human CLK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  112nMAssay Description:Inhibition of human GRK4 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  112nMAssay Description:Inhibition of human ERBB4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  112nMAssay Description:Inhibition of human DYRK2 using RRRFRPASPLRGPPK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  112nMAssay Description:Inhibition of human SSTK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  115nMAssay Description:Inhibition of HER2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  115nMAssay Description:Inhibition of human EPHB2 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  116nMAssay Description:Inhibition of CDK6/cyclin D3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCDK-activating kinase assembly factor MAT1/Cyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  120nMAssay Description:Inhibition of GST-tagged human GST-tagged CDK7/CycH/MAT1 (04 to 108 residues) using kinase tracer 236 probe incubated for 60 mins by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Bos taurus (bovine))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  121nMpH: 8.5 T: 2°CAssay Description:The activity of PKA, activated by cAMP, is measured by its ability to transfer phosphate from [gamma-32P]ATP to histone.More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 7(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  122nMAssay Description:Inhibition of MAPK7 catalytic domain (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  122nMAssay Description:Inhibition of BCR-ABL1 (unknown origin) assessed as ATP remaining by Kinase-Glo luminescent kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBreakpoint cluster region protein/Tyrosine-protein kinase ABL1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  122nMAssay Description:Inhibition of BCR (unknown origin)/recombinant human N-terminal His-tagged ABL1 (27 to end residues) expressed in baculovirus infected Sf9 cells usin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  125nMAssay Description:Inhibition of wild type EGFR (unknown origin) in presence of radiolabelled gammaATP by radioisotope filter binding assayMore data for this Ligand-Target Pair
TargetEphrin type-B receptor 4(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  126nMAssay Description:Inhibition of EPHB4 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  128nMAssay Description:Inhibition of EPHB1 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  128nMAssay Description:Inhibition of c-Met (unknown origin) using poly (Glu,Tyr) 4:1 as substrate after 1 hr by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  128nMAssay Description:Inhibition of human MAPKAPK2 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-Y(Homo sapiens)
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  128nMAssay Description:Inhibition of human CDK14/cyclin-Y using RB protein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  129nMAssay Description:Inhibition of human MYLK3 using KKRPQRRYSNVF as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase NIM1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  129nMAssay Description:Inhibition of human NIM1 using KKKVSRSGLYRSPSMPENLNRPR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  129nMAssay Description:Inhibition of human MAPKAPK5 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  130nMAssay Description:Inhibition of AKT1 (unknown origin) after 30 minsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAF proto-oncogene serine/threonine-protein kinase(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  130nMAssay Description:Inhibition of human RAF1 by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  130nMAssay Description:Inhibition of MetMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  131nMAssay Description:Inhibition of recombinant human N-terminal His-tagged HER2 (676 to 1255 residues) expressed in baculovirus expression system by competitive binding a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  131nMAssay Description:Inhibition of human NEK9 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  132nMAssay Description:Inhibition of EGFRMore data for this Ligand-Target Pair
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  133nMAssay Description:Inhibition of full length human CDK6/N-terminal GST fused human cyclinD3 expressed in baculovirus expression system using 5-FAMIPTSPITTTYFFFKKK-COOH ...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  136nMAssay Description:Inhibition of ABL1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  137nMAssay Description:Inhibition of human CDK9/cyclin-K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  137nMAssay Description:Inhibition of human EPHA8 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity testis-specific protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  138nMAssay Description:Inhibition of human TESK1 using cofilin as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type IV(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  138nMAssay Description:Inhibition of human CAMK4 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  138nMAssay Description:Inhibition of human HIPK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  138nMAssay Description:Inhibition of ErbB4 (unknown origin) incubated for 40 mins in presence of Mg/ATP mix by [gamma p33]-ATP based scintillation counting methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  139nMAssay Description:Inhibition of human STK32C using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  139nMAssay Description:Inhibition of human EPHA1 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAF proto-oncogene serine/threonine-protein kinase(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  140nMAssay Description:Inhibition of RAF1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  140nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  144nMAssay Description:Inhibition of human c-MET using KKKSPGEYVNIEFG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  146nMAssay Description:Inhibition of human HIPK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  148nMAssay Description:Inhibition of FGFR4 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage-stimulating protein receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  149nMAssay Description:Inhibition of human RON using KKSRGDYMTMQIG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  150nMAssay Description:Inhibition of GST-tagged MAPKAPK2 assessed as [33P] incorporation after 40 mins by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 4(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  150nMAssay Description:Inhibition of human EPHB4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  153nMAssay Description:Inhibition of cMetMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  155nMAssay Description:Inhibition of human EGFR using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type IV(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  157nMAssay Description:Inhibition of human CAMK4 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 13(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  160nMAssay Description:Inhibition of human p38delta using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  160nMAssay Description:Inhibitory activity against human glycogen synthase kinase-3beta (GSK3-beta) at 100 uM ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  160nMAssay Description:Inhibition of recombinant human IGF1R using Ulight-TK peptide as substrate after 60 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  162nMAssay Description:Inhibition of human BRK using poly[Glu:Tyr](4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  170nMAssay Description:Inhibition of human NEK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  173nMAssay Description:Inhibition of human DCAMKL1 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  179nMAssay Description:Inhibition of c-MET (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  179nMAssay Description:Inhibition of c-MET (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetMitogen-activated protein kinase kinase kinase 12(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  180nMAssay Description:Inhibition of human DLK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  182nMAssay Description:Inhibition of human PLK3 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCDK-activating kinase assembly factor MAT1/Cyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  183nMAssay Description:Inhibition of human CDK7/cyclin-H using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  185nMAssay Description:Inhibition of human SRPK2 using GRSRSRSRSR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  188nMAssay Description:Inhibition of human MYLK3 using KKRPQRRYSNVF as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  188nMAssay Description:Inhibition EGFRMore data for this Ligand-Target Pair
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  190nMAssay Description:Inhibition of IGF1R (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  190nMAssay Description:Inhibition of Protein kinase C beta 1More data for this Ligand-Target Pair
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  190nMAssay Description:Inhibition of cMET (unknown origin) using TK substrate-biotin as substrate preincubated with compound followed by substrate addition for 40 mins meas...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  192nMAssay Description:Inhibition of PLK1 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SBK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  193nMAssay Description:Inhibition of human SBK1 using LCGRTGRRNSI as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  193nMAssay Description:Inhibition of human SSTK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  196nMAssay Description:Inhibition of ABL (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  197nMAssay Description:Inhibition of PLK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  198nMAssay Description:Inhibition of human JNK1 using ATF2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  199nMAssay Description:Inhibition of EPHB2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  200nMAssay Description:Inhibition of recombinant GST-GSK3beta expressed in Escherichia coli BL21 (DE3)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  200nMAssay Description:Inhibition of Insulin receptor kinase-betaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Mus musculus)
Johnson & Johnson Pharmaceutical Research & Development

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  200nMAssay Description:Inhibition of Insulin receptor kinase in P19 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  201nMAssay Description:Inhibition of IGF-1R (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  202nMAssay Description:Inhibition of human HIPK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase/endoribonuclease IRE1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  204nMAssay Description:Inhibition of human ERN1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  205nMAssay Description:In vitro Thromboxane A2 (TXA2) receptor antagonism was tested by its ability to inhibit the contraction of rat aorta induced by the stable thromboxan...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  206nMAssay Description:Inhibition of human IKKbeta using KKKKERLLDDRHDSGLDSMKDEE as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  210nMAssay Description:Inhibition of ABL (unknown origin) after 30 minsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  213nMAssay Description:Inhibition of TIE2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  214nMAssay Description:Inhibition of human CDK9/cyclin-K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  217nMAssay Description:Inhibition of PKCzeta (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  222nMAssay Description:Inhibition of human PLK1 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  224nMAssay Description:Inhibition of human PLK3 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit alpha(Homo sapiens (Human))
Universidade Federal Do Rio De Janeiro

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  227nMAssay Description:Inhibition of human IKKalpha using KKKKERLLDDRHDSGLDSMKDEE as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  227nMAssay Description:Inhibition of human SRPK2 using GRSRSRSRSR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 4(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  233nMAssay Description:Inhibition of EPHB4More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit alpha(Homo sapiens (Human))
Universidade Federal Do Rio De Janeiro

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  233nMAssay Description:Inhibition of IKKalphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 16(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  235nMAssay Description:Inhibition of human STK16 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  238nMAssay Description:Inhibition of EGFR (unknown origin) using FAM-labeled peptide as substrate measured after 10 mins by mobility shift assayMore data for this Ligand-Target Pair
TargetEphrin type-B receptor 4(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  238nMAssay Description:Inhibition of human EPHB4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAF proto-oncogene serine/threonine-protein kinase(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  240nMAssay Description:Inhibition of recombinant human RAF1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium-dependent protein kinase 1(Plasmodium Falciparum)
The Scripps Research Institute

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  240nMpH: 7.5 T: 2°CAssay Description:The test compounds and enzyme were mixed in buffer, and the substrate and [gamma-33P] ATP/ATP were added to the mixture to initiate the reaction. Aft...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  240nMAssay Description:Inhibition of FGFR4 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 16(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  242nMAssay Description:Inhibition of human STK16 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetMyotonin-protein kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  242nMAssay Description:Inhibition of human DMPK using KKRNRRLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  247nMAssay Description:Inhibition of BRK (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  248nMAssay Description:Inhibition of human DYRK2 using RRRFRPASPLRGPPK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  250nMAssay Description:Inhibitory activity against recombinant human I-kappa-B-kinase beta More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity testis-specific protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  261nMAssay Description:Inhibition of human TESK1 using cofilin as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  263nMAssay Description:Inhibition of ECK (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  270nMAssay Description:Inhibition of human Fyn expressed in Sf9 cells after 1 min by ELISA in presence of 100 umol/L ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 12(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  275nMAssay Description:Inhibition of human p38gamma using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  277nMAssay Description:Inhibition of human BRK using poly[Glu:Tyr](4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  282nMAssay Description:Inhibition of ERBB4More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  283nMAssay Description:Inhibition of EGFR (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  283nMAssay Description:Inhibition of EGFR (unknown origin)More data for this Ligand-Target Pair
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  290nMAssay Description:Inhibition of recombinant human ABL expressed in insect cells using Ulight-TK peptide as substrate after 60 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek11(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  290nMAssay Description:Inhibition of human NEK11 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMuscle, skeletal receptor tyrosine-protein kinase(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  290nMAssay Description:Inhibition of human MUSK using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  295nMAssay Description:Inhibition of human MAPKAPK5 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Rattus norvegicus)
Cephalon

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  300nMAssay Description:Inhibition of PKC in rat RBL2H3 cells assessed as inhibition of mouse anti-DNP IgE-stimulated beta-hexosaminidase release preincubated for 15 mins fo...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  300nMAssay Description:Inhibition of c-Src after 60 minsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  300nMAssay Description:Inhibition of GST-fussed c-SRC after 30 minsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  300nMAssay Description:Inhibition of GST-tagged c-Src preincubated for 30 mins measured after 60 minsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <300nMAssay Description:Inhibition of Insulin receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  310nMAssay Description:Inhibition of recombinant human c-MET expressed in insect cells using Ulight-CAGAGAIETDKEYYTVKD as substrate after 60 mins by LANCE methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  314nMAssay Description:Inhibition of human HIPK4 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  317nMAssay Description:Inhibition of human RIPK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  318nMAssay Description:Inhibition of PLK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  325nMAssay Description:Inhibition of human STK32C using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage-stimulating protein receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  326nMAssay Description:Inhibition of RON (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  328nMAssay Description:Inhibition of human PLK2 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  329nMAssay Description:Inhibition of human ERBB4 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  330nMAssay Description:Inhibition of VEGFR2 in human MCF7 cells by horseradish peroxidase-coupled TMB substrate based ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  339nMAssay Description:Inhibition of ABL (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  345nMAssay Description:Inhibition of human NEK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  350nMAssay Description:Inhibition of Src tyrosine kinaseMore data for this Ligand-Target Pair
In DepthDetails Article
TargetSerine/threonine-protein kinase DCLK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  361nMAssay Description:Inhibition of human DCAMKL1 using KKLNRTLSFAEPG as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  361nMAssay Description:Inhibition of human JNK1 using ATF2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C iota type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  364nMAssay Description:Inhibition of human PKCiotaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  366nMAssay Description:Inhibition of PLK2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  391nMAssay Description:Inhibition of human MEKK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMegakaryocyte-associated tyrosine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  392nMAssay Description:Inhibition of human CTK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  395nMAssay Description:Inhibition of human RIPK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein phosphatase non-receptor type 2(Mus musculus (mouse))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  400nMAssay Description:The activity of TPK is measured by its ability to transfer 32P from [gamma-32P]ATP to Poly(Glu,Tyr; 4:l).More data for this Ligand-Target Pair
In DepthDetails Article
TargetTyrosine-protein kinase Blk(Mus musculus)
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  400nMAssay Description:Tested for inhibition of general tyrosine-specific protein kinase activity from murine B cell lysateMore data for this Ligand-Target Pair
In DepthDetails Article
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  400nMAssay Description:Inhibition of MAPKAP-K2 using KKLNRTLSVA as substrate and [33P]-gamma-ATP after 30 mins by liquid scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  405nMAssay Description:Inhibition of c-Met using biotinylated substrate preincubated for 15 mins before substrate addition measured after 30 mins by fluorescence microplate...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1/2/3/4(Homo sapiens (Human))
Egyptian National Research Centre

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  420nMAssay Description:Inhibition of Fibroblast growth factor receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  431nMAssay Description:Inhibition of EGFR (unknown origin) using Poly(Gly,Tyr) as substrate incubated for 45 mins in the presence of ATP by ADP-Glo reagent based luminescen...More data for this Ligand-Target Pair
TargetCasein kinase II subunit alpha'(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  442nMAssay Description:Inhibition of human CK2A2 using RRRDDDSDDD as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage-stimulating protein receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  443nMAssay Description:Inhibition of RONMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCitron Rho-interacting kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  458nMAssay Description:Inhibition of human STK21 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK3(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  460nMAssay Description:Inhibition of full length N-terminal nanoLuc-tagged human SIK3 expressed in HEK293 cells using NanoBRET NanoGlo substrate incubated for 2 hrs in pres...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  465nMAssay Description:Inhibition of human IKKbeta using KKKKERLLDDRHDSGLDSMKDEE as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  471nMAssay Description:Inhibition of human PLK2 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  475nMAssay Description:Inhibition of human MEKK6 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  484nMAssay Description:Inhibition of human MEKK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  490nMAssay Description:Inhibition of human recombinant IKK-beta expressed in insect Sf21 cells using phospho-Ulight-IkappaB-alpha as substrate at 30 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMegakaryocyte-associated tyrosine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  492nMAssay Description:Inhibition of human CTK using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  500nMAssay Description:Inhibition of FAK (unknown origin) assembly after 20 mins by turbidimetric methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  500nMAssay Description:Inhibition of human VEGFR2 in HUVEC cells assessed as reduction in VEGFR2 phosphorylation incubated for 30 mins by anti-phospho VEGF Tyr 1175 antibod...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProtein kinase C zeta type(Rattus norvegicus)
Cephalon

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  500nMAssay Description:Inhibition of PKC in rat RBL2H3 cells assessed as inhibition of anti-DNP IgE-stimulated TNFalpha release preincubated for 15 mins followed by mouse a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  510nMAssay Description:Inhibition of human Fyn expressed in Sf9 cells after 20 mins by ELISA in presence of 100 umol/L ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  530nMAssay Description:Inhibition of human CLK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  535nMAssay Description:Inhibition of HER4 (unknown origin) in presence of radiolabelled gammaATP by radioisotope filter binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  540nMAssay Description:Inhibition of PLK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  570nMpH: 7.4 T: 2°CAssay Description:The kinase assay uses purified recombinant enzyme and a biotinylated peptide as substrate. The biotinylated peptides were immobilized on streptavidi...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  570nMAssay Description:Inhibition of human JNK1 using ATF2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  570nMAssay Description:Inhibition of human JNK1 using ATF2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 7(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  571nMAssay Description:Inhibition of human MKK7 using JNK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 10(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  580nMAssay Description:Inhibition of MLK2 (unknown origin) by NanoBRET cellular target engagement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  581nMAssay Description:Inhibition of human JNK1 using ATF2 as substrate in presence of [gamma-32P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  585nMAssay Description:Inhibition of human HIPK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase CSK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  600nMpH: 7.5 T: 2°CAssay Description:The kinase reaction was initiated with the incubation of the 2.5 µL of the reaction cocktail (0.7 nM of His6-Src kinase domain in kinase buffer)...More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  600nMAssay Description:Inhibition of His6-tagged c-Src kinase domain using AEEEIYGEFEAKKKK as substrate pre-incubated for 10 mins before substrate addition measured after 3...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  659nMAssay Description:Inhibition of ERK2 (unknown origin) incubated for 1 hr by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  660nMAssay Description:Inhibition of human recombinant phospho-MK2 (36-400) by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  670nMAssay Description:Inhibition of recombinant MEK1 expressed in Escherichia coliMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  700nMAssay Description:Displacement of [8-3H]ATP from human recombinant phospho-MK2 (36-400) by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  710nMAssay Description:Inhibition of human HIPK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  741nMAssay Description:Inhibition of human EPHB3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  742nMAssay Description:Inhibition of human JNK2 using ATF2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Mus musculus)TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  750nMAssay Description:Inhibition of mouse EGFR by liquid scintillation countingMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek11(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  752nMAssay Description:Inhibition of human NEK11 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 21(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  765nMAssay Description:Inhibition of human MLK4 using MEK1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  771nMAssay Description:Inhibition of IKK-betaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Rattus norvegicus)
Cephalon

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  800nMAssay Description:Inhibition of PKC in rat RBL2H3 cells assessed as inhibition of ionomycin-stimulated beta-hexosaminidase release preincubated for 15 mins followed by...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase II subunit alpha'(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  844nMAssay Description:Inhibition of human CK2A2 using RRRDDDSDDD as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase receptor R3(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  850nMAssay Description:Inhibition of ALK1 (unknown origin) by radioisotopic assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBeta-adrenergic receptor kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  850nMAssay Description:Inhibition of human GRK3 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBeta-adrenergic receptor kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  861nMAssay Description:Inhibition of human GRK3 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  865nMAssay Description:Inhibition human recombinant full length His-tagged Plk1 expressed in baculovirus expression system after 1 hr by FRET-based Z'-Lyte assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  865nMAssay Description:Inhibition of recombinant full length human His-tagged PLK1 expressed in baculovirus expression system using ser/thr 16 as substrate incubated for 1 ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBeta-adrenergic receptor kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  878nMAssay Description:Inhibition of human GRK2 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
H. Lee Moffitt Cancer Center And Research Institute

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  910nMAssay Description:Inhibition of CDK7/Cyclin H (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  940nMAssay Description:Inhibition of wild type MET (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  957nMAssay Description:Inhibition of recombinant full length human GST-tagged PLK2 expressed in baculovirus expression system using ser/thr 16 as substrate incubated for 1 ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  957nMAssay Description:Inhibition human recombinant full length GST-tagged Plk2 expressed in baculovirus expression system after 1 hr by FRET-based Z'-Lyte assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  970nMAssay Description:Concentration that inhibits the binding of radioligand, [3H]-ICS 205930, to 5-hydroxytryptamine 3 receptor from rat cortexMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 4(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  988nMAssay Description:Inhibition of human MKK4 using JNK1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1.00E+3nMAssay Description:Inhibition of Mitogen activated protein kinase kinase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 11/12/13/14(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1.00E+3nMAssay Description:Inhibition of Mitogen-activated protein kinase p38More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.00E+3nMAssay Description:Inhibition of ASK1 (unknown origin) by fluorescence correlation spectroscopyMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Rattus norvegicus)
Cephalon

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.00E+3nMAssay Description:Inhibition of PKC in rat RBL2H3 cells assessed as inhibition of ionomycin-stimulated TNFalpha release preincubated for 15 mins followed by ionomycin ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCitron Rho-interacting kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.04E+3nMAssay Description:Inhibition of human STK21 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of human BMPR2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of full length N-terminal nanoLuc-tagged human SIK2 expressed in HEK293 cells using NanoBRET NanoGlo substrate incubated for 2 hrs in pres...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCyclin-dependent kinase-like 3(Homo sapiens (Human))
Masaryk University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of CDKL3 (unknown origin) by NanoBRET cellular target engagement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.25E+3nMAssay Description:Inhibition of PTK6 (unknown origin) phosphorylation using Z'-LYTE-Tyr 1 peptide substrate after 1 hr by fluorescence assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.27E+3nMAssay Description:Inhibition of human CK1a1L using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 7(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.28E+3nMAssay Description:Inhibition of human MKK7 using JNK as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.31E+3nMAssay Description:Inhibition of human CLK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.31E+3nMAssay Description:Inhibition of recombinant ERK1 (unknown origin) expressed in Escherichia coliMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.31E+3nMAssay Description:Inhibition of recombinant ERK1 expressed in Escherichia coliMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.33E+3nMAssay Description:Inhibition of IGF-induced autophosphosphorylation of GST-tagged human IGF1R expressed in baculovirus-SF21 cell system preincubated for 5 mins by time...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.37E+3nMAssay Description:Inhibition of human CK1gamma2 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.38E+3nMAssay Description:Inhibition of Mitogen-activated protein kinase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40E+3nMAssay Description:Inhibition of human ERK1 by kinase inhibition assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha/delta/epsilon/gamma-1/gamma-2(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research & Development

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.40E+3nMAssay Description:Inhibition of Protein kinase C beta 2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.41E+3nMAssay Description:Inhibition of recombinant IKK2 (unknown origin) expressed in baculovirus expression systemMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.41E+3nMAssay Description:Inhibition of recombinant IKK2 expressed in Bac-to Bac baculovirus systemMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBeta-adrenergic receptor kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.44E+3nMAssay Description:Inhibition of human GRK2 using casein as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase WNK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.45E+3nMAssay Description:Inhibition of human WNK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase WNK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.46E+3nMAssay Description:Inhibition of human WNK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 21(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.47E+3nMAssay Description:Inhibition of human MLK4 using MEK1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.50E+3nMAssay Description:Inhibition of Protein kinase C zetaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.50E+3nMAssay Description:Inhibition of Protein kinase C zetaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.53E+3nMAssay Description:Inhibition of IGF-induced autophosphosphorylation of GST-tagged human IGF1R expressed in baculovirus-SF21 cell system preincubated for 30 mins by tim...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.58E+3nMAssay Description:Inhibition of human MSSK1 using GRSRSRSRSR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 4(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.60E+3nMAssay Description:Inhibition of human MKK4 using JNK1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.65E+3nMAssay Description:Inhibition of IGF-induced autophosphosphorylation of GST-tagged human IGF1R expressed in baculovirus-SF21 cell system preincubated for 60 mins by tim...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.67E+3nMAssay Description:Inhibition of human TRKA using poly[Glu:Tyr] (4:1) as substrate in presence of [gamma-33P]ATP by scintillation counting methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.70E+3nMAssay Description:Displacement of [8-3H]ATP from human recombinant MK2 (36-400) by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  1.70E+3nMAssay Description:Inhibition of IGF-induced autophosphosphorylation of GST-tagged human IGF1R expressed in baculovirus-SF21 cell system preincubated for 10 mins by tim...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.75E+3nMAssay Description:Inhibition of JNK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.83E+3nMAssay Description:Inhibition of human EPHB3 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.85E+3nMAssay Description:Inhibition of human JNK2 using ATF2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.85E+3nMAssay Description:Inhibition of human JNK2 using ATF2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.96E+3nMAssay Description:Inhibition of human MSSK1 using GRSRSRSRSR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.97E+3nMAssay Description:Inhibition of PLK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.98E+3nMAssay Description:Inhibition of human CK1gamma3 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.00E+3nMAssay Description:Inhibition of human MAPKAPK3 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.10E+3nMAssay Description:Inhibition of CHK1 by DELFIA assayMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.27E+3nMAssay Description:Inhibition of JNK2 (unknown origin) by mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 14(Homo sapiens (Human))
University Of Namur

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  2.30E+3nMAssay Description:Inhibition of human recombinant GST-fused NIK expressed in Sf9 cells after 60 mins by radiometric protein kinase assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.41E+3nMAssay Description:Inhibition of human CK1a1L using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.64E+3nMAssay Description:Inhibition of HIPK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.78E+3nMAssay Description:Inhibition of human BMPR2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpithelial discoidin domain-containing receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.89E+3nMAssay Description:Inhibition of human DDR1 using KKSRGDYMTMQIG as substrate in presence of [gamma-33P]ATP by scintillation counting methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.07E+3nMAssay Description:Inhibition of human CK1gamma2 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.12E+3nMAssay Description:Inhibition of full-length Homo sapiens (human) recombinant FAK assessed as remaining ATP content after 4 hr by Kinase-Glo luminescence analysisMore data for this Ligand-Target Pair
In DepthDetails Article
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  3.18E+3nMAssay Description:Inhibition of JNK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTelomerase reverse transcriptase(Homo sapiens (Human))
North-West University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.31E+3nMAssay Description:Inhibition of telomerase in human SGC-7901 cell extract by TRAP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.36E+3nMAssay Description:Inhibition of human JNK2 using ATF2 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.37E+3nMAssay Description:Inhibition of human CK1gamma3 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  3.40E+3nMAssay Description:Displacement of [8-3H]ATP from human recombinant MK2 (41-364) by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.55E+3nMAssay Description:Inhibition of human MAPKAPK3 using KKLNRTLSVA as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase II subunit alpha(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  3.62E+3nMAssay Description:Inhibition of CK2alphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.85E+3nMAssay Description:Inhibition of human CK1a1 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.95E+3nMAssay Description:Inhibition of ERK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKinase suppressor of Ras 2(Human)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.98E+3nMAssay Description:Inhibition of human KSR2 using KRREILSRRPSYR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMO15-related protein kinase Pfmrk(Plasmodium falciparum)
Institute Of Research

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  4.00E+3nMAssay Description:Inhibitory activity against Plasmodium falciparum cyclin dependent protein kinase, PfmrkMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMO15-related protein kinase Pfmrk(Plasmodium falciparum)
Institute Of Research

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  4.00E+3nMAssay Description:Inhibition of Plasmodium falciparum cyclin-dependent kinaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha/RAC-beta/RAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
Alexandria University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.00E+3nMAssay Description:Inhibition of human AKT assessed as inhibition of substrate phosphorylation using AKTide-2T as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.13E+3nMAssay Description:Inhibition of human ERK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTelomerase reverse transcriptase(Homo sapiens (Human))
North-West University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  4.14E+3nMAssay Description:Inhibition of telomerase in human HepG2 cells after 24 hrs by TRAP-PCR-ELISA assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  4.19E+3nMAssay Description:Inhibition of CK1alpha1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.21E+3nMAssay Description:Inhibition of human CK1a1 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Srms(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.23E+3nMAssay Description:Inhibition of human SRMS using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-1A(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.29E+3nMAssay Description:Inhibition of ALK3 (unknown origin) by radioisotopic assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.49E+3nMAssay Description:Inhibition of ERK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-1(Homo sapiens (Human))
Vanderbilt University

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.53E+3nMAssay Description:Shown are the IC50s (concentrations causing 50% inhibition) of DM and the analogues for the in vitro kinase assays using the following purified human...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKinase suppressor of Ras 1(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.59E+3nMAssay Description:Inhibition of human KSR1 using KRREILSRRPSYR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.79E+3nMAssay Description:Inhibition of NEK2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  4.90E+3nMAssay Description:Inhibition of ERK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  5.09E+3nMAssay Description:Inhibition of ERK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 7(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.52E+3nMAssay Description:Inhibition of human ERK5 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 7(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.37E+3nMAssay Description:Inhibition of MAPK7 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.54E+3nMAssay Description:Inhibition of ErK1 (unknown origin) after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetKinase suppressor of Ras 2(Human)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.82E+3nMAssay Description:Inhibition of human KSR2 using KRREILSRRPSYR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  6.87E+3nMAssay Description:Inhibition of human ALK5 in presence of 1 microM ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.17E+3nMAssay Description:Inhibition of human CK1gamma1 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.18E+3nMAssay Description:Inhibition of human ERK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.44E+3nMAssay Description:Inhibition of human CK1gamma1 using KRRRAL[pS]VASLPGL as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.79E+3nMAssay Description:Inhibition of ERK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.93E+3nMAssay Description:Inhibition of LCKMore data for this Ligand-Target Pair
TargetKinase suppressor of Ras 1(Homo sapiens)
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  7.94E+3nMAssay Description:Inhibition of human KSR1 using KRREILSRRPSYR as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTelomerase reverse transcriptase(Homo sapiens (Human))
North-West University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  8.30E+3nMAssay Description:Inhibition of telomerase in human HepG2 cells after 48 hrs by TRAP-PCR-ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTelomerase reverse transcriptase(Homo sapiens (Human))
North-West University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  8.32E+3nMAssay Description:Inhibition of telomerase in human SW1116 cells after 24 hrs by TRAP-PCR-ELISA assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.45E+3nMAssay Description:Inhibition of MAPK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTelomerase reverse transcriptase(Homo sapiens (Human))
North-West University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.50E+3nMAssay Description:Inhibition of telomerase activity in human SGC-7901 cells incubated for 24 hrs by TRAP-PCR-ELISA assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTelomerase reverse transcriptase(Homo sapiens (Human))
North-West University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.67E+3nMAssay Description:Inhibition of telomerase (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase Srms(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.77E+3nMAssay Description:Inhibition of human SRMS using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTelomerase reverse transcriptase(Homo sapiens (Human))
North-West University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  8.97E+3nMAssay Description:Inhibition of telomerase in human MGC-803 cells after 24 hrs by TRAP-PCR-ELISA assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.00E+3nM Kd:  290nMpH: 7.2 T: 2°CAssay Description:Binding was detected as a change in the intrinsic tryptophan fluorescence of the PI3K upon the addition of inhibitor. The inhibitor was incubated wit...More data for this Ligand-Target Pair
TargetActivin receptor type-1B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.12E+3nMAssay Description:Inhibition of ALK4 (unknown origin) by radioisotopic assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.58E+3nMAssay Description:Inhibition of ERK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAF proto-oncogene serine/threonine-protein kinase(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of cRAFMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Mus musculus)TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of Epidermal growth factor receptor in P19 cellsMore data for this Ligand-Target Pair
TargetProtein kinase C zeta type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of Protein kinase C zetaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Mus musculus (Mouse))
Johnson & Johnson Pharmaceutical Research & Development

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of Mitogen-activated protein kinase/extracellular signal-regulated kinase 2 in P19 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition human recombinant GST-tagged Plk3 catalytic domain (58 to 340 residues) expressed in baculovirus expression system after 1 hr by FRET-base...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of recombinant human GST-tagged PLK3 (58 to 340 residues) expressed in baculovirus expression system using ser/thr 16 as substrate incubat...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek6(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of NEK6 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-1(Homo sapiens (Human))
Vanderbilt University

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.00E+4nMAssay Description:Inhibition of ALK2 (unknown origin) by radioisotopic assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.06E+4nMAssay Description:Shown are the IC50s (concentrations causing 50% inhibition) of DM and the analogues for the in vitro kinase assays using the following purified human...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 7(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.18E+4nMAssay Description:Inhibition of human ERK5 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase WNK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.21E+4nMAssay Description:Inhibition of human WNK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.50E+4nMAssay Description:Concentration that inhibits the binding of radioligand, [3H]-ICS 205930, to 5-hydroxytryptamine 3 receptor from rat cortexMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.60E+4nMAssay Description:Concentration that inhibits the binding of radioligand, [3H]-ICS 205930, to 5-hydroxytryptamine 3 receptor from rat cortexMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase WNK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.75E+4nMAssay Description:Inhibition of human WNK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.85E+4nMAssay Description:Inhibition of human recombinant ALK5 expressed in insect Sf9 cells using casein as substrate by radioisotopic assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBile salt export pump(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.87E+4nMAssay Description:Inhibition of human BSEP overexpressed in Sf9 cell membrane vesicles assessed as uptake of [3H]-taurocholate in presence of ATP measured after 15 to ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBile salt export pump(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.87E+4nMAssay Description:Binding affinity towards nicotinic acetylcholine receptor (nACh) using [3H](-)-nicotine as radioligand in rat brainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.90E+4nMAssay Description:Concentration that inhibits the binding of radioligand, [3H]-ICS 205930, to 5-hydroxytryptamine 3 receptor from rat cortexMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.24E+4nMAssay Description:Inhibition of human recombinant N-terminal GST-tagged Plk1 in presence of 62.5 uM of ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.42E+4nMAssay Description:Inhibition of human NEK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.57E+4nMAssay Description:Inhibition of CDK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.70E+4nMAssay Description:Inhibition of CHK2 by DELFIA assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  2.74E+4nMAssay Description:Inhibition of ERK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.00E+4nMAssay Description:Inhibition of human ERK1 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.40E+4nMAssay Description:Inhibition of human ERK2 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetATP-binding cassette sub-family C member 4(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.79E+4nMAssay Description:Inhibition of human MRP4 overexpressed in Sf9 cell membrane vesicles assessed as uptake of [3H]-estradiol-17beta-D-glucuronide in presence of ATP and...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.00E+4nMAssay Description:Inhibition of human N-terminal GST-tagged CDK2 (1 to 298 residues)/Cyclin A (174 to 432 residues) expressed in Escherichia coli Turner (DE3) cells as...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  6.37E+4nMAssay Description:Inhibition of human NEK3 using MBP as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPotassium voltage-gated channel subfamily H member 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.04E+4nMAssay Description:Inhibition of human ERGMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Tec(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.28E+5nMAssay Description:Concentration that inhibits the binding of radioligand, [3H]-ICS 205930, to 5-hydroxytryptamine 3 receptor from rat cortexMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.29E+5nMAssay Description:Inhibition of human recombinant N-terminal GST-tagged Plk1 in presence of 3.12 mM of ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetATP-binding cassette sub-family C member 3(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.33E+5nMAssay Description:Inhibition of human MRP3 overexpressed in Sf9 insect cell membrane vesicles assessed as uptake of [3H]-estradiol-17beta-D-glucuronide in presence of ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetATP-binding cassette sub-family C member 2(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: >1.33E+5nMAssay Description:Inhibition of human MRP2 overexpressed in Sf9 cell membrane vesicles assessed as uptake of [3H]-estradiol-17beta-D-glucuronide in presence of ATP and...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  1.78E+5nMAssay Description:Concentration that inhibits the binding of radioligand, [3H]-ICS 205930, to 5-hydroxytryptamine 3 receptor from rat cortexMore data for this Ligand-Target Pair
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50: <1.00E+6nMAssay Description:Inhibition of human Trk-A using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillation counting methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  5.95E+7nMAssay Description:Inhibition of human TIE2 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillation counting methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  9.73E+7nMAssay Description:Inhibition of human FGFR4 using using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillation counting ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for MET kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C eta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.80nMAssay Description:Binding constant for PRKCH kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.570nMAssay Description:Binding constant for PAK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-1(Homo sapiens (Human))
Vanderbilt University

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  470nMAssay Description:Binding constant for ACVR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.700nMAssay Description:Binding constant for MARK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 11(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Binding constant for MLK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  300nMAssay Description:Binding constant for EPHA1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  250nMAssay Description:Binding constant for FGFR4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for RET(M918T) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase NLK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  220nMAssay Description:Binding constant for full-length NLKMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Tec(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30E+3nMAssay Description:Binding constant for TEC kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for PKAC-alpha kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for BRAF(V600E) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 2(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.10nMAssay Description:Binding constant for PAK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  370nMAssay Description:Binding constant for EGFR kinase domainMore data for this Ligand-Target Pair
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for KIT(V559D) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase receptor R3(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVRL1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  290nMAssay Description:Binding constant for EPHA6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 11B(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for CDC2L1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMuscle, skeletal receptor tyrosine-protein kinase(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  86nMAssay Description:Binding constant for MUSK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for LATS1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 24(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  120nMAssay Description:Binding constant for MST3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for IGF1R kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0390nMAssay Description:Binding constant for CAMKK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  7.10nMAssay Description:Binding constant for full-length PAK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-2A(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.160nMAssay Description:Binding constant for CAMKK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for full-length GSK3AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.30E+3nMAssay Description:Binding constant for RPS6KA6(Kin.Dom.2 - N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for AURKA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  26nMAssay Description:Binding constant for BRSK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3nMAssay Description:Binding constant for full-length MARK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.70nMAssay Description:Binding constant for full-length PDPK1More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase 17A(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  14nMAssay Description:Binding constant for DRAK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase, smooth muscle(Homo sapiens (Human))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for MYLK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TNNI3K(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.00E+3nMAssay Description:Binding constant for full-length TNNI3KMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.25nMAssay Description:Binding constant for PRKCE kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9.5nMAssay Description:Binding constant for KIT(V559D,T670I) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataKd:  110nMAssay Description:Binding affinity to ASK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 11(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataKd:  20nMAssay Description:Binding affinity to human MLK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataKd:  2.90nMAssay Description:Binding affinity to human FLT3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataKd:  19nMAssay Description:Binding affinity to human KIT incubated for 1 hr by kinase binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataEC50:  2.35E+4nMAssay Description:Inhibition of human recombinant full-length FAK assessed as remaining ATP after 4 hrs by Kinase-Glo-luminescence assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.30nMAssay Description:Binding affinity to recombinant GSK3B (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
TargetBMP-2-inducible protein kinase(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1nMAssay Description:Binding affinity to recombinant BMP2K (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  11nMAssay Description:Binding affinity to recombinant FLT1 (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetMAP/microtubule affinity-regulating kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.5nMAssay Description:Binding affinity to recombinant MARK3 (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetMAP/microtubule affinity-regulating kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.5nMAssay Description:Binding affinity to recombinant MARK4 (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetMitogen-activated protein kinase 15(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.5nMAssay Description:Binding affinity to recombinant MAPK15 (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30nMAssay Description:Binding affinity to recombinant CDK2 (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetSerine/threonine-protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1nMAssay Description:Binding affinity to recombinant STK4 (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetSerine/threonine-protein kinase 24(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  120nMAssay Description:Binding affinity to recombinant MST3 (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase Mer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.40nMAssay Description:Binding affinity to recombinant MERTK (unknown origin) assessed as dissociation constant by DSF assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.10nMAssay Description:Binding constant for FLT3(N841I) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase, smooth muscle(Gallus gallus (chicken))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for MLCK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-G-associated kinase(Homo sapiens (Human))
Ku Leuven

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for GAK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  38nMAssay Description:Binding constant for KIT(V559D,V654A) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-1A(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.70E+3nMAssay Description:Binding constant for BMPR1A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for BMPR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9.20E+3nMAssay Description:Binding constant for full-length LIMK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for FLT4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 3(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for EPHA3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  120nMAssay Description:Binding constant for EGFR(E746-A750del) kinase domainMore data for this Ligand-Target Pair
TargetEphrin type-A receptor 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for EPHA8 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.90nMAssay Description:Binding constant for RPS6KA2(Kin.Dom.1 - N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1nMAssay Description:Binding constant for DAPK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Binding constant for LCK kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  220nMAssay Description:Binding constant for full-length JNK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.140nMAssay Description:Binding constant for PHKG2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 4(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for EPHB4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 16(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for STK16 kinase domainMore data for this Ligand-Target Pair
TargetActivin receptor type-2B(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.60E+3nMAssay Description:Binding constant for ACVR2B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  24nMAssay Description:Binding constant for full-length TSSK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  310nMAssay Description:Binding constant for FGFR3(G697C) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 16(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  24nMAssay Description:Binding constant for PCTK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20nMAssay Description:Binding constant for PAK7/PAK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  880nMAssay Description:Binding constant for MAPKAPK2 kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  750nMAssay Description:Binding constant for NEK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for TLK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  95nMAssay Description:Binding constant for EPHA5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for full-length JNK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.30nMAssay Description:Binding constant for MAP4K1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 2, skeletal/cardiac muscle(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  61nMAssay Description:Binding constant for MYLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  18nMAssay Description:Binding constant for RPS6KA6(Kin.Dom.1 - C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.50E+3nMAssay Description:Binding constant for full-length DLKMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  32nMAssay Description:Binding constant for full-length CLK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  24nMAssay Description:Binding constant for MAP4K4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 9(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  100nMAssay Description:Binding constant for full-length CDK9More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for PRKD1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform epsilon(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  73nMAssay Description:Binding constant for full-length CSNK1EMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.10nMAssay Description:Binding constant for FLT3(D835H) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.20E+3nMAssay Description:Binding constant for RPS6KA4(Kin.Dom.2 - N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for full-length MEK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.20E+3nMAssay Description:Binding constant for RIPK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  56nMAssay Description:Binding constant for TYK2(Kin.Dom.2/JH1 - catalytic) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Binding constant for full-length MKNK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase RIO3(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  76nMAssay Description:Binding constant for full-length RIOK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 12(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for full-length p38-gammaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Binding constant for AKT1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 36(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.70E+3nMAssay Description:Binding constant for STK36 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTubulin alpha-1A chain(Rattus norvegicus)
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  770nMAssay Description:Binding constant for ERBB4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  100nMAssay Description:Binding constant for FGFR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.80nMAssay Description:Binding constant for AXL kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 4(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20E+3nMAssay Description:Binding constant for MAP3K4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpithelial discoidin domain-containing receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for DDR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 11(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for full-length p38-betaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  21nMAssay Description:Binding constant for full-length MEK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  57nMAssay Description:Binding constant for MRCKA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  220nMAssay Description:Binding constant for ABL1(M351T) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for RIPK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 25(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for YSK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyotonin-protein kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.5nMAssay Description:Binding constant for DMPK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  29nMAssay Description:Binding constant for full-length PKAC-betaMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 14(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  160nMAssay Description:Binding constant for full-length PFTK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for EGFR(L858R) kinase domainMore data for this Ligand-Target Pair
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  32nMAssay Description:Binding constant for PRKG1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  290nMAssay Description:Binding constant for ABL1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek6(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for NEK6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.20nMAssay Description:Binding constant for CHEK1 kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  10nMAssay Description:Binding constant for MLK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.550nMAssay Description:Binding constant for CAMK2G kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10E+3nMAssay Description:Binding constant for EGFR(G719C) kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase MRCK beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for MRCKB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin-IIIb(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  300nMAssay Description:Binding constant for MYO3B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  69nMAssay Description:Binding constant for full-length GSK3BMore data for this Ligand-Target Pair
TargetCasein kinase I isoform alpha-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  250nMAssay Description:Binding constant for full-length CSNK1A1LMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit PRKX(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  13nMAssay Description:Binding constant for full-length PRKXMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  220nMAssay Description:Binding constant for VEGFR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  910nMAssay Description:Binding constant for full-length CLK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.40E+3nMAssay Description:Binding constant for full-length ERK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 3(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  13nMAssay Description:Binding constant for IRAK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10E+3nMAssay Description:Binding constant for EGFR(G719S) kinase domainMore data for this Ligand-Target Pair
TargetMAP kinase-activated protein kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for MAPKAPK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Srms(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  740nMAssay Description:Binding constant for SRMS kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase HCK(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Binding constant for HCK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32B(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  98nMAssay Description:Binding constant for full-length YANK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 6(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ERK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10nMAssay Description:Binding constant for full-length SNF1LK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 26(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for full-length MST4More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  10nMAssay Description:Binding constant for PDGFRA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TNK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.5nMAssay Description:Binding constant for full-length TNK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.90nMAssay Description:Binding constant for PIM2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for ITK kinase domainMore data for this Ligand-Target Pair
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.40nMAssay Description:Binding constant for DAPK1 kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for BRAF kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for EGFR(L747-T751del,Sins) kinase domainMore data for this Ligand-Target Pair
TargetEphrin type-A receptor 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  290nMAssay Description:Binding constant for EPHA4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for MAP3K5 kinase domainMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type IV(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  41nMAssay Description:Binding constant for CAMK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for ABL1(H396P) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.30E+3nMAssay Description:Binding constant for PTK6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  67nMAssay Description:Binding constant for full-length SRPK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek1(Homo sapiens (Human))
Technische Universit£T Darmstadt

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  860nMAssay Description:Binding constant for NEK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  84nMAssay Description:Binding constant for full-length CDK5More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 19(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for CDK11 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 4(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  70nMAssay Description:Binding constant for MEK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  33nMAssay Description:Binding constant for FYN kinase domainMore data for this Ligand-Target Pair
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  96nMAssay Description:Binding constant for EGFR(L747-E749del, A750P) kinase domainMore data for this Ligand-Target Pair
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for TIE2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAP2-associated protein kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20nMAssay Description:Binding constant for AAK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAtypical kinase COQ8B, mitochondrial(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for full-length ADCK4More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  7.30E+3nMAssay Description:Binding constant for full-length ERK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.570nMAssay Description:Binding constant for PAK6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20-like serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0240nMAssay Description:Binding constant for SLK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 5-phosphate 4-kinase type-2 beta(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  77nMAssay Description:Binding constant for full-length PIP5K2BMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase RIO1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  130nMAssay Description:Binding constant for full-length RIOK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C theta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.5nMAssay Description:Binding constant for PRKCQ kinase domainMore data for this Ligand-Target Pair
TargetInterferon-induced, double-stranded RNA-activated protein kinase(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  360nMAssay Description:Binding constant for PRKR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0860nMAssay Description:Binding constant for SNARK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for AURKB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  18nMAssay Description:Binding constant for MAP4K5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  10nMAssay Description:Binding constant for JAK3(Kin.Dom.2/JH1 - catalytic) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeukocyte tyrosine kinase receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  37nMAssay Description:Binding constant for LTK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for PLK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.5nMAssay Description:Binding constant for full-length BRSK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for LATS2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAnkyrin repeat and protein kinase domain-containing protein 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for ANKK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  86nMAssay Description:Binding constant for SRC kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-beta serine/threonine-protein kinase(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  44nMAssay Description:Binding constant for AKT2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit delta(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.320nMAssay Description:Binding constant for CAMK2D kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase II subunit alpha'(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.5nMAssay Description:Binding constant for full-length CSNK2A2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 4(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ERK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N2(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.5nMAssay Description:Binding constant for PKN2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Binding constant for AKT3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 6(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.40nMAssay Description:Binding constant for MEK6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  290nMAssay Description:Binding constant for EGFR(S752-I759del) kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 7(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.60E+3nMAssay Description:Binding constant for ERK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20E+3nMAssay Description:Binding constant for RPS6KA1(Kin.Dom.2 - C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 8(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  510nMAssay Description:Binding constant for CDK8 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for TGFBR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1D(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10nMAssay Description:Binding constant for CAMK1D kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  69nMAssay Description:Binding constant for RPS6KA3(Kin.Dom.1 - N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK3(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for DCAMKL3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.80nMAssay Description:Binding constant for PDGFRB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.5nMAssay Description:Binding constant for full-length SRPK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  480nMAssay Description:Binding constant for full-length LIMK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.20nMAssay Description:Binding constant for PIM1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.160nMAssay Description:Binding constant for CAMK2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1B(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for full-length DYRK1BMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for MKNK2 kinase domainMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30nMAssay Description:Binding constant for CAMK2B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(E545K) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 20(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ZAK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetWee1-like protein kinase(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.60E+3nMAssay Description:Binding constant for WEE1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 10(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0370nMAssay Description:Binding constant for LOK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.00E+3nMAssay Description:Binding constant for ABL1(E255K) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCytoplasmic tyrosine-protein kinase BMX(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Binding constant for full-length BMXMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 17(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  96nMAssay Description:Binding constant for full-length PCTK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 15(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  35nMAssay Description:Binding constant for ERK8 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor Tie-1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  65nMAssay Description:Binding constant for TIE1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek7(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.50E+3nMAssay Description:Binding constant for full-length NEK7More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for JAK1(Kin.Dom.1/JH2 - pseudokinase) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDiscoidin domain-containing receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for DDR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.80nMAssay Description:Binding constant for TRKB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin-IIIa(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  500nMAssay Description:Binding constant for MYO3A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase FRK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  45nMAssay Description:Binding constant for FRK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 10(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  52nMAssay Description:Binding constant for MLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for full-length BTKMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 14(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for full-length p38-alphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase TTK(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  61nMAssay Description:Binding constant for TTK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK gamma(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  37nMAssay Description:Binding constant for DMPK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMaternal embryonic leucine zipper kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  33nMAssay Description:Binding constant for full-length MELKMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4-phosphate 5-kinase type-1 alpha(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  43nMAssay Description:Binding constant for full-length PIP5K1AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for RPS6KA2(Kin.Dom.2 - C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 11A(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for CDC2L2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.5nMAssay Description:Binding constant for FLT3(D835Y) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4nMAssay Description:Binding constant for TRKA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  24nMAssay Description:Binding constant for FER kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase STK11(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  61nMAssay Description:Binding constant for full-length LKB1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  150nMAssay Description:Binding constant for FLT1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.510nMAssay Description:Binding constant for PIM3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.5nMAssay Description:Binding constant for PRKCD kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAF proto-oncogene serine/threonine-protein kinase(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for RAF1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  810nMAssay Description:Binding constant for NEK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for PRKG2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK4(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.770nMAssay Description:Binding constant for PLK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 7(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  45nMAssay Description:Binding constant for full-length CDK7More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit epsilon(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.10nMAssay Description:Binding constant for full-length IKK-epsilonMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N1(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30nMAssay Description:Binding constant for PKN1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  43nMAssay Description:Binding constant for RPS6KA1(Kin.Dom.1 - N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5'-AMP-activated protein kinase catalytic subunit alpha-2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Binding constant for AMPK-alpha2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase TXK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  230nMAssay Description:Binding constant for TXK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity testis-specific protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  320nMAssay Description:Binding constant for TESK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.10E+3nMAssay Description:Binding constant for NEK9 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-1B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  680nMAssay Description:Binding constant for ACVR1B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Mer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.40nMAssay Description:Binding constant for MERTK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for full-length CAMK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  310nMAssay Description:Binding constant for YANK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
The Ohio State University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  52nMAssay Description:Binding constant for YES kinase domainMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase Fgr(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for FGR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  91nMAssay Description:Binding constant for ABL1(Q252H) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PKMYT1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for ABL1(Y253F) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.20nMAssay Description:Binding constant for CLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5nMAssay Description:Binding constant for full-length MEK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNT-3 growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for TRKC kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  7nMAssay Description:Binding constant for full-length CDK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ERBB2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargeteIF-2-alpha kinase GCN2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for GCN2(Kin.Dom.2,S808G) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20E+3nMAssay Description:Binding constant for EPHA2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Binding constant for full-length CDK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for TLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9.60nMAssay Description:Binding constant for CLK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for RET kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for ABL1(T315I) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fes/Fps(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  23nMAssay Description:Binding constant for FES kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.10E+3nMAssay Description:Binding constant for EPHB2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 1(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.40nMAssay Description:Binding constant for ARK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 33(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.80nMAssay Description:Binding constant for full-length STK33More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  18nMAssay Description:Binding constant for PRKD3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.90nMAssay Description:Binding constant for FLT3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAtypical kinase COQ8A, mitochondrial(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ADCK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17B(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  21nMAssay Description:Binding constant for full-length DRAK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  90nMAssay Description:Binding constant for FGFR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  32nMAssay Description:Binding constant for ALK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.20nMAssay Description:Binding constant for MAP4K3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  73nMAssay Description:Binding constant for DCAMKL2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  120nMAssay Description:Binding constant for RPS6KA4(Kin.Dom.1 - C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for RPS6KA5(Kin.Dom.1 - C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for TNK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5'-AMP-activated protein kinase catalytic subunit alpha-1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.70nMAssay Description:Binding constant for AMPK-alpha1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  890nMAssay Description:Binding constant for RPS6KA5(Kin.Dom.2 - N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for CSNK1G1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.40nMAssay Description:Binding constant for MARK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.650nMAssay Description:Binding constant for full-length PHKG1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.40nMAssay Description:Binding constant for FLT3(ITD) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  44nMAssay Description:Binding constant for ZAP70 kinase domainMore data for this Ligand-Target Pair
TargetInsulin receptor-related protein(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  81nMAssay Description:Binding constant for INSRR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for INSR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.20nMAssay Description:Binding constant for SNF1LK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase family member 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  470nMAssay Description:Binding constant for SgK085 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  11nMAssay Description:Binding constant for JAK2(Kin.Dom.2/JH1 - catalytic) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  64nMAssay Description:Binding constant for PTK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCitron Rho-interacting kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  340nMAssay Description:Binding constant for CIT kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  23nMAssay Description:Binding constant for full-length AURKCMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  88nMAssay Description:Binding constant for FGFR3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.70nMAssay Description:Binding constant for TNIK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  14nMAssay Description:Binding constant for SYK kinase domainMore data for this Ligand-Target Pair
TargetEphrin type-B receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for EPHB3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase CSK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  330nMAssay Description:Binding constant for full-length CSKMore data for this Ligand-Target Pair
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for KIT kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBMP-2-inducible protein kinase(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.60nMAssay Description:Binding constant for BIKE kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  630nMAssay Description:Binding constant for EPHA7 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for DCAMKL1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Binding constant for CSF1R kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for NDR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  72nMAssay Description:Binding constant for PRKD2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Blk(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for BLK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform epsilon(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  73nMAssay Description:Binding constant for CSNK1E kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20-like serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0240nMAssay Description:Binding constant for SLK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEukaryotic translation initiation factor 2-alpha kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for EIF2AK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  90nMAssay Description:Binding constant for FGFR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for FLT4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(E545K) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9.60nMAssay Description:Binding constant for CLK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9.90nMAssay Description:Binding constant for ULK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fgr(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for FGR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAtypical kinase COQ8B, mitochondrial(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ADCK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeukocyte tyrosine kinase receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  37nMAssay Description:Binding constant for LTK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 18 [3-474](Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for PCTK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Blk(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for BLK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C iota type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  26nMAssay Description:Binding constant for PRKCI kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5nMAssay Description:Binding constant for MEK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  480nMAssay Description:Binding constant for LIMK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1G(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  23nMAssay Description:Binding constant for CAMK1G kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9.5nMAssay Description:Binding constant for KIT(V559D,T670I) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for MRCKB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  23nMAssay Description:Binding constant for AURKC kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  290nMAssay Description:Binding constant for EPHA4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAP2-associated protein kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20nMAssay Description:Binding constant for AAK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  37nMAssay Description:Binding constant for GRK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  46nMAssay Description:Binding constant for ABL1(F317L)-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  130nMAssay Description:Binding constant for MET(M1250T) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(C420R) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17A(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  14nMAssay Description:Binding constant for DRAK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for BRAF kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.40nMAssay Description:Binding constant for SGK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.10nMAssay Description:Binding constant for FLT3(D835H) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.640nMAssay Description:Binding constant for KIT(D816V) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase RIO3(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  76nMAssay Description:Binding constant for RIOK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase receptor R3(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVRL1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  24nMAssay Description:Binding constant for MAP4K4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  250nMAssay Description:Binding constant for CSNK1A1L kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 3-kinase C2 domain-containing subunit gamma(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  430nMAssay Description:Binding constant for PIK3C2G kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  24nMAssay Description:Binding constant for TSSK1B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.5nMAssay Description:Binding constant for BRSK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeucine-rich repeat serine/threonine-protein kinase 2(Homo sapiens (Human))
The University Of Sydney

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.10nMAssay Description:Binding constant for LRRK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  10nMAssay Description:Binding constant for PDGFRA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  52nMAssay Description:Binding constant for ABL1(M351T)-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 4(Homo sapiens (Human))
Inner Mongolia Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.30nMAssay Description:Binding constant for PAK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  780nMAssay Description:Binding constant for full-length CSNK1G2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  600nMAssay Description:Binding constant for EGFR(L861Q) kinase domainMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type 1G(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  23nMAssay Description:Binding constant for CAMK1G kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 10(Homo sapiens (Human))
Korea Institute Of Science And Technology

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for JNK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 2-beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.5nMAssay Description:Binding constant for full-length PTK2BMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 3(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.180nMAssay Description:Binding constant for MST2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Kyung Hee University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Binding constant for ROS1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 18 [3-474](Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for full-length PCTK3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor TYRO3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  280nMAssay Description:Binding constant for TYRO3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  300nMAssay Description:Binding constant for EGFR(L747-S752del, P753S) kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  910nMAssay Description:Binding constant for PLK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for full-length CSNK1G3More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.640nMAssay Description:Binding constant for KIT(D816V) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.60nMAssay Description:Binding constant for full-length DAPK2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.190nMAssay Description:Binding constant for full-length MST1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4nMAssay Description:Binding constant for MARK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform delta(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.40E+3nMAssay Description:Binding constant for full-length CSNK1DMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  40nMAssay Description:Binding constant for LYN kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 14(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.00E+3nMAssay Description:Binding constant for TGFBR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  240nMAssay Description:Binding constant for EPHB1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase II subunit alpha(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  36nMAssay Description:Binding constant for full-length CSNK2A1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for ABL2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.700nMAssay Description:Binding constant for MARK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  88nMAssay Description:Binding constant for FGFR3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek6(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for NEK6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32B(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  98nMAssay Description:Binding constant for YANK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for BTK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ICK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for ICK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor TYRO3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  280nMAssay Description:Binding constant for TYRO3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4-phosphate 5-kinase type-1 alpha(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  43nMAssay Description:Binding constant for PIP5K1A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2 homolog(Plasmodium falciparum (isolate 3D7))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  800nMAssay Description:Binding constant for PFPK5(P.falciparum) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  400nMAssay Description:Binding constant for PIK3CA(H1047L) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30nMAssay Description:Binding constant for S6K1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  600nMAssay Description:Binding constant for EGFR(L861Q) kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase SIK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.20nMAssay Description:Binding constant for SIK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.40nMAssay Description:Binding constant for ABL1(T315I)-nonphosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-3(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ERBB3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for PRKD1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBMP-2-inducible protein kinase(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.60nMAssay Description:Binding constant for BIKE kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 4(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20E+3nMAssay Description:Binding constant for MAP3K4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  770nMAssay Description:Binding constant for ERBB4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 14(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for p38-alpha kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1nMAssay Description:Binding constant for DAPK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for AURKB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PRP4 homolog(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  220nMAssay Description:Binding constant for PRP4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.430nMAssay Description:Binding constant for KIT(D816H) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  18nMAssay Description:Binding constant for PRKD3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  200nMAssay Description:Binding constant for PLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPeripheral plasma membrane protein CASK(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for CASK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.160nMAssay Description:Binding constant for CAMK2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for MAPKAPK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-1A(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.70E+3nMAssay Description:Binding constant for BMPR1A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 12(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for p38-gamma kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N2(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.5nMAssay Description:Binding constant for PKN2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  21nMAssay Description:Binding constant for MEK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  43nMAssay Description:Binding constant for RSK1(Kin.Dom.1-N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for RPS6KA5(Kin.Dom.1-N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  64nMAssay Description:Binding constant for FAK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  300nMAssay Description:Binding constant for EGFR(L747-S752del, P753S) kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 10(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  52nMAssay Description:Binding constant for MLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for MTOR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.5nMAssay Description:Binding constant for FLT3(D835Y) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase NLK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  220nMAssay Description:Binding constant for NLK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.570nMAssay Description:Binding constant for PAK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.510nMAssay Description:Binding constant for PIM3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase HCK(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Binding constant for HCK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 36(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.70E+3nMAssay Description:Binding constant for STK36 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for LATS2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 33(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.80nMAssay Description:Binding constant for STK33 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor Tie-1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  65nMAssay Description:Binding constant for TIE1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  260nMAssay Description:Binding constant for ASK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5'-AMP-activated protein kinase catalytic subunit alpha-2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Binding constant for AMPK-alpha2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1D(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10nMAssay Description:Binding constant for CAMK1D kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for PLK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  22nMAssay Description:Binding constant for ABL1(E255K)-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.10E+3nMAssay Description:Binding constant for TYK2(JH2domain-pseudokinase) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetWee1-like protein kinase 2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for WEE2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20nMAssay Description:Binding constant for ULK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for RSK3(Kin.Dom.2-C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.10E+3nMAssay Description:Binding constant for NEK9 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for TLK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3C2B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  7nMAssay Description:Binding constant for CDK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Binding constant for TAOK2 kinase domainMore data for this Ligand-Target Pair
TargetProtein kinase C theta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.5nMAssay Description:Binding constant for PRKCQ kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  910nMAssay Description:Binding constant for JNK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase RIO2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  390nMAssay Description:Binding constant for RIOK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRhodopsin kinase GRK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.970nMAssay Description:Binding constant for GRK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4nMAssay Description:Binding constant for TRKA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  95nMAssay Description:Binding constant for EPHA5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1A(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4nMAssay Description:Binding constant for DYRK1A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 13(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for LZK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-1B(Homo sapiens (Human))
Ewha Womans University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  680nMAssay Description:Binding constant for ACVR1B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for RET(M918T) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for JAK1(JH2domain-pseudokinase) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.80nMAssay Description:Binding constant for MAP4K2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for RIPK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9.80nMAssay Description:Binding constant for JAK2(JH1domain-catalytic) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  290nMAssay Description:Binding constant for EGFR(S752-I759del) kinase domainMore data for this Ligand-Target Pair
TargetEphrin type-A receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20E+3nMAssay Description:Binding constant for EPHA2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.25nMAssay Description:Binding constant for PRKCE kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3nMAssay Description:Binding constant for MARK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.90nMAssay Description:Binding constant for MEK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for MKNK2 kinase domainMore data for this Ligand-Target Pair
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.40nMAssay Description:Binding constant for DAPK1 kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase DCLK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  73nMAssay Description:Binding constant for DCAMKL2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  36nMAssay Description:Binding constant for ABL1(H396P)-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpithelial discoidin domain-containing receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for DDR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.30nMAssay Description:Binding constant for HPK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for MET kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  32nMAssay Description:Binding constant for CLK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 10(Homo sapiens (Human))
Korea Institute Of Science And Technology

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for JNK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.20nMAssay Description:Binding constant for MAP4K3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  11nMAssay Description:Binding constant for ABL1(Q252H)-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium-dependent protein kinase 1(Plasmodium Falciparum)
The Scripps Research Institute

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.25nMAssay Description:Binding constant for PFCDPK1(P.falciparum) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 3(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for EPHA3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.30nMAssay Description:Binding constant for FLT3(K663Q) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for KIT kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  810nMAssay Description:Binding constant for NEK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 14(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  160nMAssay Description:Binding constant for PFTK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  56nMAssay Description:Binding constant for TYK2(JH1domain-catalytic) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit delta(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.320nMAssay Description:Binding constant for CAMK2D kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.90nMAssay Description:Binding constant for PIM2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Vertex Pharmaceuticals

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for ITK kinase domainMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase Srms(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  740nMAssay Description:Binding constant for SRMS kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  120nMAssay Description:Binding constant for RPS6KA4(Kin.Dom.1-N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNT-3 growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for TRKC kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual serine/threonine and tyrosine protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  11nMAssay Description:Binding constant for RIPK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase VRK2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for VRK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 15(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  35nMAssay Description:Binding constant for ERK8 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 5-phosphate 4-kinase type-2 beta(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  77nMAssay Description:Binding constant for PIP5K2B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TBK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.890nMAssay Description:Binding constant for TBK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for MEK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.40E+3nMAssay Description:Binding constant for ERK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK3(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for DCAMKL3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 25(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for YSK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MAK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.60E+3nMAssay Description:Binding constant for MAK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.80E+3nMAssay Description:Binding constant for PIK3CG kinase domainMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  250nMAssay Description:Binding constant for DYRK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.90nMAssay Description:Binding constant for RSK3(Kin.Dom.1-N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 7(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.60E+3nMAssay Description:Binding constant for ERK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  31nMAssay Description:Binding constant for IKK-beta kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMegakaryocyte-associated tyrosine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  260nMAssay Description:Binding constant for CTK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  390nMAssay Description:Binding constant for HIPK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-2A(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.90E+3nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for EPHA8 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMicrotubule-associated serine/threonine-protein kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  150nMAssay Description:Binding constant for MAST1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Binding constant for RET(V804M) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Binding constant for CDK4-cyclinD3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for GSK3A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 35(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for STK35 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 11(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for p38-beta kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  24nMAssay Description:Binding constant for FER kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.790nMAssay Description:Binding constant for ULK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Central University Of Punjab

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  32nMAssay Description:Binding constant for ALK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Binding constant for MKNK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0390nMAssay Description:Binding constant for CAMKK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMisshapen-like kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1nMAssay Description:Binding constant for MINK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  21nMAssay Description:Binding constant for ABL1(Q252H)-nonphosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for KIT(V559D) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(M1043I) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 3(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  13nMAssay Description:Binding constant for IRAK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  84nMAssay Description:Binding constant for CDK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  310nMAssay Description:Binding constant for FGFR3(G697C) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 4(Homo sapiens (Human))
Inner Mongolia Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.30nMAssay Description:Binding constant for PAK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Binding constant for CSF1R kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase TTK(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  61nMAssay Description:Binding constant for TTK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAnkyrin repeat and protein kinase domain-containing protein 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for ANKK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage-stimulating protein receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  400nMAssay Description:Binding constant for MST1R kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 13(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  70nMAssay Description:Binding constant for CDC2L5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.190nMAssay Description:Binding constant for MST1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.90nMAssay Description:Binding constant for FLT3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-beta serine/threonine-protein kinase(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  44nMAssay Description:Binding constant for AKT2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Binding constant for AKT3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  300nMAssay Description:Binding constant for EPHA1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  22nMAssay Description:Binding constant for ABL1-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 1(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.40nMAssay Description:Binding constant for ARK5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1B(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for DYRK1B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  40nMAssay Description:Binding constant for IRAK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17B(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  21nMAssay Description:Binding constant for DRAK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMuscle, skeletal receptor tyrosine-protein kinase(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  86nMAssay Description:Binding constant for MUSK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 11B(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for CDC2L1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for RET kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type IV(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  41nMAssay Description:Binding constant for CAMK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAtypical kinase COQ8A, mitochondrial(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ADCK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for TGFBR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 19(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for CDK11 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.20E+3nMAssay Description:Binding constant for RIPK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.60nMAssay Description:Binding constant for DAPK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRhodopsin kinase GRK7(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.860nMAssay Description:Binding constant for GRK7 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.10E+3nMAssay Description:Binding constant for EPHB2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.450nMAssay Description:Binding constant for TAOK1 kinase domainMore data for this Ligand-Target Pair
TargetCasein kinase II subunit alpha(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  940nMAssay Description:Binding constant for CSNK2A1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  18nMAssay Description:Binding constant for MAP4K5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit alpha(Homo sapiens (Human))
Universidade Federal Do Rio De Janeiro

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.80nMAssay Description:Binding constant for IKK-alpha kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.70nMAssay Description:Binding constant for PDPK1 kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase RIO1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  130nMAssay Description:Binding constant for RIOK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Mer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.40nMAssay Description:Binding constant for MERTK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK gamma(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  37nMAssay Description:Binding constant for DMPK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMembrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PKMYT1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  890nMAssay Description:Binding constant for RPS6KA5(Kin.Dom.2-C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  23nMAssay Description:Binding constant for ABL1(Y253F)-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.30E+3nMAssay Description:Binding constant for BMPR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDiscoidin domain-containing receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for DDR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  29nMAssay Description:Binding constant for PKAC-beta kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.80E+3nMAssay Description:Binding constant for MAP3K3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase, smooth muscle(Homo sapiens (Human))
Tumor Biology Center

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for MYLK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 11(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Binding constant for MLK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4nMAssay Description:Binding constant for MARK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  14nMAssay Description:Binding constant for SYK kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase 6(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.10E+3nMAssay Description:Binding constant for ERK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  250nMAssay Description:Binding constant for FGFR4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.90nMAssay Description:Binding constant for ABL1(T315I)-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N1(Homo sapiens (Human))
Heinrich-Heine-Universit£T D£Sseldorf

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30nMAssay Description:Binding constant for PKN1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for ERBB2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  40nMAssay Description:Binding constant for LYN kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 2, skeletal/cardiac muscle(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  61nMAssay Description:Binding constant for MYLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 7(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Binding constant for MKK7 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 14(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.00E+3nMAssay Description:Binding constant for TGFBR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  38nMAssay Description:Binding constant for KIT(V559D,V654A) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20/SPS1-related proline-alanine-rich protein kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  130nMAssay Description:Binding constant for STK39 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase family member 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  470nMAssay Description:Binding constant for MYLK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(I800L) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0860nMAssay Description:Binding constant for SNARK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 7(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  45nMAssay Description:Binding constant for CDK7 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Binding constant for AKT1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Binding constant for RET(V804L) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.280nMAssay Description:Binding constant for ROCK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase TXK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  230nMAssay Description:Binding constant for TXK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
University Of Chinese Academy Of Science

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  44nMAssay Description:Binding constant for ZAP70 kinase domainMore data for this Ligand-Target Pair
TargetPhosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.650nMAssay Description:Binding constant for PHKG1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.40nMAssay Description:Binding constant for MARK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  18nMAssay Description:Binding constant for ABL1(H396P)-nonphosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.20nMAssay Description:Binding constant for PIM1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(Q546K) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  780nMAssay Description:Binding constant for CSNK1G2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for INSR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4-phosphate 5-kinase type-1 gamma(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.70E+3nMAssay Description:Binding constant for PIP5K1C kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Binding constant for LCK kinase domainMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase-like 1 [2-358](Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  330nMAssay Description:Binding constant for CDKL1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  370nMAssay Description:Binding constant for EGFR kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase BRSK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  26nMAssay Description:Binding constant for BRSK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 8(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  510nMAssay Description:Binding constant for CDK8 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Hanyang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for BRAF(V600E) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20nMAssay Description:Binding constant for PAK7 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(E545A) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32A(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  13nMAssay Description:Binding constant for YANK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  37nMAssay Description:Binding constant for ABL1-nonphosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.10nMAssay Description:Binding constant for JAK1(JH1domain-catalytic) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  57nMAssay Description:Binding constant for MRCKA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.10nMAssay Description:Binding constant for FLT3(N841I) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.220nMAssay Description:Binding constant for FLT3(R834Q) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  10nMAssay Description:Binding constant for MLK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Vertex Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  69nMAssay Description:Binding constant for GSK3B kinase domainMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.80nMAssay Description:Binding constant for AXL kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  970nMAssay Description:Binding constant for CSNK1A1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 13(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  240nMAssay Description:Binding constant for p38-delta kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek1(Homo sapiens (Human))
Technische Universit£T Darmstadt

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  860nMAssay Description:Binding constant for NEK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.220nMAssay Description:Binding constant for TAOK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  910nMAssay Description:Binding constant for CLK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Binding constant for JAK3(JH1domain-catalytic) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(E542K) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeucine-rich repeat serine/threonine-protein kinase 2(Homo sapiens (Human))
The University Of Sydney

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.390nMAssay Description:Binding constant for LRRK2(G2019S) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 4(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for RIPK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for MLCK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for TNK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for DCAMKL1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase/endoribonuclease IRE1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  21nMAssay Description:Binding constant for ERN1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Binding constant for CAMK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  28nMAssay Description:Binding constant for NDR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-G-associated kinase(Homo sapiens (Human))
Ku Leuven

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for GAK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK3 [59-1321](Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.460nMAssay Description:Binding constant for QSK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for TLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCitron Rho-interacting kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  340nMAssay Description:Binding constant for CIT kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  32nMAssay Description:Binding constant for PRKG1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 6(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.40nMAssay Description:Binding constant for MEK6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  100nMAssay Description:Binding constant for FGFR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTransient receptor potential cation channel subfamily M member 6(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for TRPM6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5'-AMP-activated protein kinase catalytic subunit alpha-1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.70nMAssay Description:Binding constant for AMPK-alpha1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CD kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TNK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.5nMAssay Description:Binding constant for TNK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for EGFR(L747-T751del,Sins) kinase domainMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
The Ohio State University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  52nMAssay Description:Binding constant for YES kinase domainMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 9(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  100nMAssay Description:Binding constant for CDK9 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.50E+3nMAssay Description:Binding constant for CSNK1G1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.30E+3nMAssay Description:Binding constant for BRK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-1B(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Binding constant for BMPR1B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for IGF1R kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase FRK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  45nMAssay Description:Binding constant for FRK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterferon-induced, double-stranded RNA-activated protein kinase(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  360nMAssay Description:Binding constant for PRKR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  240nMAssay Description:Binding constant for EPHB1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.70E+3nMAssay Description:Binding constant for HIPK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit PRKX(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  13nMAssay Description:Binding constant for PRKX kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.20nMAssay Description:Binding constant for CLK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4-kinase beta(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  460nMAssay Description:Binding constant for PIK4CB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 11A(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for CDC2L2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for EGFR(L858R) kinase domainMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 4(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  70nMAssay Description:Binding constant for MEK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase-like 3(Homo sapiens (Human))
Masaryk University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.10E+3nMAssay Description:Binding constant for CDKL3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 12(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.50E+3nMAssay Description:Binding constant for DLK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.40nMAssay Description:Binding constant for MAP3K2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  96nMAssay Description:Binding constant for EGFR(L747-E749del, A750P) kinase domainMore data for this Ligand-Target Pair
TargetInsulin receptor-related protein(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  81nMAssay Description:Binding constant for INSRR kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIK3CA(H1047Y) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for ABL2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase NIM1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for NIM1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  73nMAssay Description:Binding constant for SRPK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek7(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.50E+3nMAssay Description:Binding constant for NEK7 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.5nMAssay Description:Binding constant for PRKCD kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  86nMAssay Description:Binding constant for SRC kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.40nMAssay Description:Binding constant for FLT3(ITD) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCytoplasmic tyrosine-protein kinase BMX(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Binding constant for BMX kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 4(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ERK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9.20E+3nMAssay Description:Binding constant for LIMK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.570nMAssay Description:Binding constant for PAK6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.70nMAssay Description:Binding constant for TNIK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-2B(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.60E+3nMAssay Description:Binding constant for ACVR2B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SBK1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.20nMAssay Description:Binding constant for SBK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Tec(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30E+3nMAssay Description:Binding constant for TEC kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  22nMAssay Description:Binding constant for KIT(L576P) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek3(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for NEK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  56nMAssay Description:Binding constant for NDR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  75nMAssay Description:Binding constant for HIPK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  42nMAssay Description:Binding constant for LATS1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargeteIF-2-alpha kinase GCN2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for GCN2(Kin.Dom.2,S808G) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 19(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.860nMAssay Description:Binding constant for YSK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase-like 5(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  340nMAssay Description:Binding constant for CDKL5 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 2(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.10nMAssay Description:Binding constant for PAK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 6(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Binding constant for EPHB6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHormonally up-regulated neu tumor-associated kinase(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  620nMAssay Description:Binding constant for HUNK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10nMAssay Description:Binding constant for SIK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.600nMAssay Description:Binding constant for KIT(A829P) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  7.30E+3nMAssay Description:Binding constant for ERK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.770nMAssay Description:Binding constant for EGFR(T790M) kinase domainMore data for this Ligand-Target Pair
TargetMaternal embryonic leucine zipper kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  33nMAssay Description:Binding constant for MELK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyotonin-protein kinase(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.5nMAssay Description:Binding constant for DMPK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetWee1-like protein kinase(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.60E+3nMAssay Description:Binding constant for WEE1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  220nMAssay Description:Binding constant for JNK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  550nMAssay Description:Binding constant for ABL1(F317I)-nonphosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  310nMAssay Description:Binding constant for YANK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.550nMAssay Description:Binding constant for CAMK2G kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  72nMAssay Description:Binding constant for PRKD2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TNNI3K(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.00E+3nMAssay Description:Binding constant for TNNI3K kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Binding constant for PRKG2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.20E+3nMAssay Description:Binding constant for RSK1(Kin.Dom.2-C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin-IIIa(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  500nMAssay Description:Binding constant for MYO3A kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.80nMAssay Description:Binding constant for PDGFRB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.80nMAssay Description:Binding constant for TRKB kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Glaxosmithkline

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.20nMAssay Description:Binding constant for CHEK1 kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 15(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.5nMAssay Description:Binding constant for MAP3K15 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.30E+3nMAssay Description:Binding constant for RSK4(Kin.Dom.2-C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAF proto-oncogene serine/threonine-protein kinase(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for RAF1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin-IIIb(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  300nMAssay Description:Binding constant for MYO3B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 17(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  96nMAssay Description:Binding constant for PCTK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase II subunit alpha'(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  230nMAssay Description:Binding constant for CSNK2A2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  130nMAssay Description:Binding constant for ABL1(F317I)-phosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Binding constant for ASK1 kinase domainMore data for this Ligand-Target Pair
TargetHomeodomain-interacting protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  190nMAssay Description:Binding constant for HIPK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 24(Homo sapiens (Human))
Gachon University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  120nMAssay Description:Binding constant for MST3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  7.10nMAssay Description:Binding constant for PAK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 4(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.20E+3nMAssay Description:Binding constant for EPHB4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  120nMAssay Description:Binding constant for EGFR(E746-A750del) kinase domainMore data for this Ligand-Target Pair
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Institut Curie

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  880nMAssay Description:Binding constant for MAPKAPK2 kinase domainMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 7(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  67nMAssay Description:Binding constant for TAK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  220nMAssay Description:Binding constant for VEGFR2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for TIE2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit epsilon(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.10nMAssay Description:Binding constant for IKK-epsilon kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10E+3nMAssay Description:Binding constant for EGFR(G719S) kinase domainMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 5-phosphate 4-kinase type-2 gamma(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for PIP5K2C kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.5nMAssay Description:Binding constant for SRPK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase CSK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  330nMAssay Description:Binding constant for CSK kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  750nMAssay Description:Binding constant for NEK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit alpha(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  19nMAssay Description:Binding constant for PKAC-alpha kinase domainMore data for this Ligand-Target Pair
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Binding constant for AURKA kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform delta(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.40E+3nMAssay Description:Binding constant for CSNK1D kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase-like 2(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  510nMAssay Description:Binding constant for CDKL2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.240nMAssay Description:Binding constant for ROCK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 20(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ZAK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 10(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0370nMAssay Description:Binding constant for LOK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for MET(Y1235D) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSNF-related serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  90nMAssay Description:Binding constant for SNRK kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK4(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.770nMAssay Description:Binding constant for PLK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.70nMAssay Description:Binding constant for IRAK4 kinase domainMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.160nMAssay Description:Binding constant for CAMKK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for EPHB3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 3(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.180nMAssay Description:Binding constant for MST2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase STK11(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  61nMAssay Description:Binding constant for LKB1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetUncharacterized serine/threonine-protein kinase SBK3(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  25nMAssay Description:Binding constant for SgK110 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 16(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  24nMAssay Description:Binding constant for PCTK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  50nMAssay Description:Binding constant for CDK4-cyclinD1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Binding constant for ABL1(F317L)-nonphosphorylated kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  33nMAssay Description:Binding constant for FYN kinase domainMore data for this Ligand-Target Pair
TargetSRSF protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  67nMAssay Description:Binding constant for SRPK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  630nMAssay Description:Binding constant for EPHA7 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for NEK4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C eta type(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4.80nMAssay Description:Binding constant for PRKCH kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek11(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.10E+3nMAssay Description:Binding constant for NEK11 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase OSR1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  440nMAssay Description:Binding constant for OSR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 26(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  140nMAssay Description:Binding constant for MST4 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  910nMAssay Description:Binding constant for PLK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.350nMAssay Description:Binding constant for EGFR(L858R,T790M) kinase domainMore data for this Ligand-Target Pair
TargetRibosomal protein S6 kinase alpha-6(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  18nMAssay Description:Binding constant for RSK4(Kin.Dom.1-N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity testis-specific protein kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  320nMAssay Description:Binding constant for TESK1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Kyung Hee University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Binding constant for ROS1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fer(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Average Binding Constant for FER; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 3(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  55nMAssay Description:Average Binding Constant for EPHA3; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  590nMAssay Description:Average Binding Constant for EPHB1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Average Binding Constant for CLK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase FRK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  260nMAssay Description:Average Binding Constant for FRK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3nMAssay Description:Average Binding Constant for PAK7/PAK5; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  73nMAssay Description:Average Binding Constant for INSR; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1nMAssay Description:Average Binding Constant for DAPK3; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.80E+3nMAssay Description:Average Binding Constant for ABL1(E255K) ; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase CSK(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  440nMAssay Description:Average Binding Constant for CSK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Average Binding Constant for VEGFR2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit delta(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.5nMAssay Description:Average Binding Constant for CAMK2D; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  31nMAssay Description:Average Binding Constant for FLT4; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  210nMAssay Description:Average Binding Constant for LYN; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Carna Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.80nMAssay Description:Average Binding Constant for FLT3; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Average Binding Constant for FGFR3; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK4(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Average Binding Constant for CLK4; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.400nMAssay Description:Average Binding Constant for PAK6; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  160nMAssay Description:Average Binding Constant for FGFR2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Beta Pharma

US Patent
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  60nMAssay Description:Average Binding Constant for FGFR1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38-like(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  77nMAssay Description:Average Binding Constant for STK38L; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  400nMAssay Description:Average Binding Constant for ABL1(M351T) ; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.5nMAssay Description:Average Binding Constant for CAMK2G; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3nMAssay Description:Average Binding Constant for DAPK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.100nMAssay Description:Average Binding Constant for CAMK2A; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 2, skeletal/cardiac muscle(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  110nMAssay Description:Average Binding Constant for MYLK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-G-associated kinase(Homo sapiens (Human))
Ku Leuven

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  68nMAssay Description:Average Binding Constant for GAK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1nMAssay Description:Average Binding Constant for PHkg2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase C(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  11nMAssay Description:Average Binding Constant for Aurora3; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  690nMAssay Description:Average Binding Constant for EPHA7; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  22nMAssay Description:Average Binding Constant for MKNK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase 3(Mus musculus)
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.150nMAssay Description:Average Binding Constant for STK3_m; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  120nMAssay Description:Average Binding Constant for MAP3K5; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  17nMAssay Description:Average Binding Constant for ACK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBMP-2-inducible protein kinase(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.70nMAssay Description:Average Binding Constant for BIKE; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.70nMAssay Description:Average Binding Constant for PDGFRB; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase HCK(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  12nMAssay Description:Average Binding Constant for HCK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  500nMAssay Description:Average Binding Constant for ABL1(Q252H) ; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Average Binding Constant for RPS6KA5 (Kin.Dom 1); NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  11nMAssay Description:Average Binding Constant for JAK2 (Kin.Dom. 2); NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2nMAssay Description:Average Binding Constant for NTRK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10E+3nMAssay Description:Average Binding Constant for JNK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 12(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  92nMAssay Description:Average Binding Constant for p38-gamma; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  740nMAssay Description:Average Binding Constant for NEK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17A(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  23nMAssay Description:Average Binding Constant for STK17A; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 10(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0300nMAssay Description:Average Binding Constant for STK10; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek9(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6.70E+3nMAssay Description:Average Binding Constant for NEK9; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  74nMAssay Description:Binding constant for CHEK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Binding constant for CDK3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  69nMAssay Description:Binding constant for RSK2(Kin.Dom.1-N-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  350nMAssay Description:Binding constant for MAP3K1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 2-beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.5nMAssay Description:Binding constant for PYK2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fes/Fps(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  23nMAssay Description:Binding constant for FES kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.10E+3nMAssay Description:Binding constant for EGFR(G719C) kinase domainMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PknB(Mycobacterium tuberculosis)
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  88nMAssay Description:Binding constant for PKNB(M.tuberculosis) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  290nMAssay Description:Binding constant for EPHA6 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.140nMAssay Description:Binding constant for PHKG2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.20E+3nMAssay Description:Binding constant for RPS6KA4(Kin.Dom.2-C-terminal) kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivin receptor type-1(Homo sapiens (Human))
Vanderbilt University

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  470nMAssay Description:Binding constant for ACVR1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 16(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  270nMAssay Description:Binding constant for STK16 kinase domainMore data for this Ligand-Target Pair
TargetCasein kinase I isoform gamma-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for CSNK1G3 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30nMAssay Description:Binding constant for CAMK2B kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 15(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  260nMAssay Description:Binding constant for PFTAIRE2 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Southeast University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  150nMAssay Description:Binding constant for FLT1 kinase domainMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.40nMAssay Description:Binding affinity to non phosphorylated PIM1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  710nMAssay Description:Average Binding Constant for BTK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  26nMAssay Description:Average Binding Constant for MAP4K5; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK3(Mus musculus)
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3nMAssay Description:Average Binding Constant for ULK3 m; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.5nMAssay Description:Average Binding Constant for PHkg1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5'-AMP-activated protein kinase catalytic subunit alpha-1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  9nMAssay Description:Average Binding Constant for PRKAA1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  160nMAssay Description:Average Binding Constant for ABL2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.40E+3nMAssay Description:Average Binding Constant for CSNK1G2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Average Binding Constant for CAMK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 10(Homo sapiens (Human))
Korea Institute Of Science And Technology

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  340nMAssay Description:Average Binding Constant for JNK3; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8.10nMAssay Description:Average Binding Constant for CDK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  240nMAssay Description:Average Binding Constant for EPHA6; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 36(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.90E+3nMAssay Description:Average Binding Constant for STK36; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Jinan University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  70nMAssay Description:Average Binding Constant for EGFR; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Chiron

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  100nMAssay Description:Average Binding Constant for KIT; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  340nMAssay Description:Average Binding Constant for ABL1(H396P) ; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  7nMAssay Description:Average Binding Constant for SYK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  240nMAssay Description:Average Binding Constant for TEK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
National Cancer Institute-Bethesda

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  15nMAssay Description:Average Binding Constant for PIM1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 16(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  200nMAssay Description:Average Binding Constant for STK16; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetAurora kinase A(Homo sapiens (Human))
Isf College Of Pharmacy

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  16nMAssay Description:Average Binding Constant for Aurora2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1D(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2nMAssay Description:Average Binding Constant for CAMK1D; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAP2-associated protein kinase 1(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  1.30nMAssay Description:Average Binding Constant for AAK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  870nMAssay Description:Average Binding Constant for EPHA2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 16(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  25nMAssay Description:Average Binding Constant for PCTK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0500nMAssay Description:Average Binding Constant for CAMKK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3.50E+3nMAssay Description:Average Binding Constant for CLK3; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 5(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  150nMAssay Description:Average Binding Constant for EPHA5; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  60nMAssay Description:Average Binding Constant for RPS6KA3 (Kin.Dom. 1); NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Korea Institute Of Science And Technology (Kist)

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  20nMAssay Description:Average Binding Constant for LCK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  100nMAssay Description:Average Binding Constant for SRC; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  170nMAssay Description:Average Binding Constant for ABL1(Y253F); NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2nMAssay Description:Average Binding Constant for PAK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  38nMAssay Description:Average Binding Constant for ABL1(T315I) ; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 3(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.5nMAssay Description:Average Binding Constant for PAK3; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  10nMAssay Description:Average Binding Constant for RPS6KA2 (Kin.Dom. 1); NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
The Ohio State University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  49nMAssay Description:Average Binding Constant for YES; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  89nMAssay Description:Average Binding Constant for CDK5; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20-like serine/threonine-protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0200nMAssay Description:Average Binding Constant for SLK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1G(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  53nMAssay Description:Average Binding Constant for CAMK1G; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.0500nMAssay Description:Average Binding Constant for CAMKK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-2(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  4nMAssay Description:Average Binding Constant for PIM2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  410nMAssay Description:Average Binding Constant for ABL1 ; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  51nMAssay Description:Average Binding Constant for FYN; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
TargetCasein kinase I isoform epsilon(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  690nMAssay Description:Average Binding Constant for CSNK1E; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  3nMAssay Description:Average Binding Constant for CAMK2B; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  50nMAssay Description:Average Binding Constant for PRKACA; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.100nMAssay Description:Average Binding Constant for MARK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  520nMAssay Description:Average Binding Constant for JNK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 2(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  5.10E+3nMAssay Description:Average Binding Constant for RIPK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 8(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  300nMAssay Description:Average Binding Constant for EPHA8; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  27nMAssay Description:Average Binding Constant for CLK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  710nMAssay Description:Average Binding Constant for EPHA4; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 4(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.200nMAssay Description:Average Binding Constant for STK4; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fgr(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  30nMAssay Description:Average Binding Constant for FGR; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 4(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  2.20E+3nMAssay Description:Average Binding Constant for MAP3K4; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  6nMAssay Description:Average Binding Constant for TNIK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 4(Homo sapiens (Human))
Inner Mongolia Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  8nMAssay Description:Average Binding Constant for PAK4; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  68nMAssay Description:Average Binding Constant for PTK2; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK4(Homo sapiens (Human))
Abbott Laboratories

LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  0.75nMAssay Description:Average Binding Constant for STK18; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17B(Homo sapiens (Human))
Zhejiang University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  26nMAssay Description:Average Binding Constant for STK17B; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCytoplasmic tyrosine-protein kinase BMX(Homo sapiens (Human))
Beijing Normal University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  410nMAssay Description:Average Binding Constant for BMX; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 1(Homo sapiens (Human))
University Of Florida

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  690nMAssay Description:Average Binding Constant for LIMK1; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase TTK(Homo sapiens (Human))
Ambit Biosciences

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKd:  100nMAssay Description:Average Binding Constant for TTK; NA=Not Active at 10 uMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 2463 total ) | Next | Last >>